Conserved Protein Domain Family
PHA03212

?
PHA03212: PHA03212 
serine/threonine kinase US3; Provisional
Statistics
?
PSSM-Id: 165478
View PSSM: PHA03212
Aligned: 2 rows
Threshold Bit Score: 827.711
Threshold Setting Gi: 155042203
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
9625940     1 MNDVDATDTFVGQGKFRGAISTSPSHIMQTCGFIQQMFPVEMSpgieSEDDPNY-DVNMDIQSFNIFDGVHETEAEASVA 79 
155042203   8 MSTICALTSLSDQGKVHGNASHVPNMLQRQQFVCDSTFVSNMN----YDDDCLYeDKHMDTDIYDMLADEDTSDVDNTLA 83 
9625940    80 LCAEARVGINKAGFVILKTFTPGAEGFAFACMDSKTCEHVVIKAGQRQGTATEATVLRALTHPSVVQLKGTFTYNKMTCL 159
155042203  84 VCATARAGIEKAGFSVLETFTPGAEGFTFACIENKTRENVVIKAGQRGGTVTEAHILRNINHPVIIRLMGTFTYNSFTCL 163
9625940   160 ILPRYRTDLYCYLAAKRNLPICDILAIQRSVLRALQYLHNNSIIHRDIKSENIFINHPGDVCVGDFGAACFPVDINANRY 239
155042203 164 VLPRYKTDLYCYLSDRRRIAICDMLSIERSVLRAIQYLHENRIIHRDVKAENIFINHPGDVCLGDFGAACYPVDITQNKY 243
9625940   240 YGWAGTIATNSPELLARDPYGPAVDIWSAGIVLFEMATGQNSLFERDGLDGNCDSERQIKLIIRRSGTHPNEFPINPTSN 319
155042203 244 YGWAGTIATNAPELLARDPYGPAVDIWSAGIVLFEMATCHDSLFEKDGLDGDCDSDRQIKLIIRRTGVHPSEFPIDAQAT 323
9625940   320 LRRQYiGLAKRSSRKPGSRPLWTNLYELPIDLEYLICKMLSFDARHRPSAEVLLNHSVFQTLPDPYPNPME 390
155042203 324 LDEIY-RTCQKTSRKPGTRPTWTNLYELPLELEYLICKMLAFDAHKRPSAKALLDFAAFYDIPDPYPNPTN 393
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap