Conserved Protein Domain Family
PHA03210

?
PHA03210: PHA03210 
serine/threonine kinase US3; Provisional
Statistics
?
PSSM-Id: 165476
View PSSM: PHA03210
Aligned: 2 rows
Threshold Bit Score: 927.562
Threshold Setting Gi: 38638261
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
38638261   2 TRKRFLCPSvcrsraARTGESKRRRLHSHDRRRCAITPDFDEDGRMAHIANPRPNPLECAEASQKV-IMAPSRSDTTGAH 80 
57790997   1 MRFRRICSR------SRAEKRRRTTENPLTSKRVCVLDSFSRTMSLRPYAEILPTAEGVERLAELVsVTMTERAEPVTEN 74 
38638261  81 RCLEDAAPVGEllvprsSADLHESQRGQPSGATDSQASTLETESAPPSADSS---SSAKLQRDDEFLAKYRVIGTLPAGS 157
57790997  75 TAVNSIPPANE------NGQNFAYAGDGPSTTEKVDGSHTDFDEASSDYAGPvplAQTRLKHSDEFLQHFRVLDDLVEGA 148
38638261 158 FGkiLVCALRASVGEAEASR--------VPRSERRVAKRVRATSRLAIYLENEILALQYMNHENILKVEEVLRSEAYTYM 229
57790997 149 YG--FICDVRRYTEEEQRRRgvnstnqgKSKCKRLIAKYVKNGTRAASQLENEILVLGRLNHENVLKIQEILRYPDNTYM 226
38638261 230 ITRKYDYDLYSFMYDGDLQWKDRPLLWQTRAIMKQLLCAVEYMHDKLLMHRDIKLENVFLNGDGTIVLGDLGTAMTFEKP 309
57790997 227 LTQRYQFDLYSYMYDEAFDWKDSPMLKQTRRIMKQLMSAVSYIHSKKLIHRDIKLENIFLNCDGKTVLGDFGTVTPFENE 306
38638261 310 RVARDYGWVGTVTTNSPEMLAGDGYCEITDLWSCGLIMLDMLSKDLLPLNGNTKKPGKQLRRIIRSLSVCDEEFPDPPCK 389
57790997 307 REPFEYGWVGTVATNSPEILARDSYCEITDIWSCGVVLLEMVSHEFCPIGDGGGNPHQQLLKVIDSLSVCDEEFPDPPCN 386
38638261 390 LFDYIDSAEYTHTPMSVPPLIRRMGLPADFEYPLVKMLTFDWHRRPGASELLALPLFSSTITEERLFVWGlksgaaHFSS 469
57790997 387 LYNYLHYASIDRAGHTVPSLIRNLHLPADVEYPLVKMLTFDWRLRPSAAEVLAMPLFSAEEERTITIIHG------KHKP 460
38638261 470 WKPACRiesdtAALSLTMSDD 490
57790997 461 IRPEIR-----ARVPRSMSEG 476
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap