Conserved Protein Domain Family
PHA03209

?
PHA03209: PHA03209 
serine/threonine kinase US3; Provisional
Statistics
?
PSSM-Id: 177557
View PSSM: PHA03209
Aligned: 5 rows
Threshold Bit Score: 545.626
Threshold Setting Gi: 126802155
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
9629798    22 SESMDTTPPLQLSvhpqnpSCGGAAANEDLYSDISDGDLECSDCDSASESDEDDDDGLMPPKEKAKEVAASFGFKVIKTL 101
50313310   20 SESMDTTPPLPPPtpsvdpSYSGAAADEDLYSDISEGDLEYSDCDSASESDEDDDDCLIPSKEKAREVAASFGYTVIKTL 99 
216905922  21 SESMDTTPPLPPTvhsvdpCYSGAAADEDLYSDISEGDLEYSDCDSASESDEDDDDGLIPSKEKAREVAASFGYTVIKTL 100
270339511   1 MEDVSVTPNEAPR----------GMLDDDLYSDISDGDFEDICDDTDTETSDSDDESLKPTKQEALEAVHALNYTIVKTL 70 
126802155   1 -------------------MADAGIPDEILYSDISDDEIIIDGDGDSSGDEDDDDGGL--TRQAAARIVTDLGFEVLQPL 59 
9629798   102 TPGSEGRVMVATKEGQPDQVVLKIGQKGTTLIEAMMLRNVNHPCVIKMKDTLVSGGITCMVLPHYNSDLYTFLTRRSTRI 181
50313310  100 TPGSEGRVMVATKDGQPEPVVLKIGQKGTTLIEAMMLRNVNHPSVIQMKDTLVSGAITCMVLPHYSSDLYTFLTKESRRI 179
216905922 101 TPGAEGRVMVATKDGQPEPVVLKIGQKGTTLIEAMMLRNVDHPSVIRMKDTLVSGAITCMVLPHYSSDLYTFLTKGAKRV 180
270339511  71 TPGSEGRVFVAKPPGSETPVVLKIGMKGATLIEALLLQNINHESIIKLLDTLFYKELTCIVLPRYKSDLYTYLSNNMRPL 150
126802155  60 QSGSEGRVFVARRPGEADTVVLKVGQKPSTLMEGMLLQRLSHDNVMRMKQMLARGPATCLVLPHFRCDLYSYLTMRDGPL 139
9629798   182 PIDQALIIERQILEGLRYLHAQRIIHRDVKTENIFINSVDQVCIADFGAAQFPVVDPMDLGLAGTVETNAPEVLARAKYN 261
50313310  180 PIDQALIIEKQILEGLRYLHAQRIIHRDVKTENIFINSVDQVCIADFGAAQFPVVEPADLGLAGTVETNAPEVLARAKYN 259
216905922 181 PIDQALVIEKQILEGLRYLHAQRIIHRDVKTENIFINSVNQVCIADFGAAQFPVVEPADLGLAGTVETNAPEVLARAKYN 260
270339511 151 SLASAFTIQKQILKGLNYLHQHKIIHRDIKIENILIDDESSVCIGDLGAAQFPVNAPDFLGVAGTVETNSPEVLAKDAYN 230
126802155 140 DMRDAGCVIRAVLRGLAYLHGMRIMHRDVKAENIFLEDVDTVCLGDLGAARCNVAAPNFYGLAGTIETNAPEVLARDRYD 219
9629798   262 SKVDIWSAGIVLFEMLAYPSTLFEDPPSTPQEYVKSCHSQLLRIISKLKINPEEFPREPESRLVRGYIEYASLERKPHTR 341
50313310  260 SKADIWSAGIVLFEMLAYPSTLFEDPPSTPEEYVKSCHSQLLKIISTLKINPEEFPRDPGSRLVRGYIEYSRLERKPYTR 339
216905922 261 SKADIWSAGIVLFEMLAYPSTLFEDPPSTPEEYVKSCHSQLLRIISTLKINPEEFPRDPGSRLVRGYIEYSRLERKPYTR 340
270339511 231 SKADIWSAGIILFEMIAYPHSIFDDEDSS--DSSRSSRNHLRKVITTLKVHPEEFPGDPTSKLTIDFIHYASCVRQPYTR 308
126802155 220 TKVDVWGAGVVLFETLAYPKTI-----TGGDEPAINGEMHLIDLIRALGVHPEEFP--PDTRLRSEFVRYAGTHRQPYTQ 292
9629798   342 YPCFQRVNLHIDGEFLIHKMLAFNAAMRPSAEELLSYPMFMNL 384
50313310  340 YPCFQRVNLHIDGEFLVHKMLAFNAAMRPSAEELLSYPMFAQL 382
216905922 341 YPCFQRVNLHIDAEFLVHKMLAFNAAMRPSAEELLAYPMFAQL 383
270339511 309 YDCMSKYDLPLDGEFVVHKMLTFDAKFRPSAAEILNYPMFRDT 351
126802155 293 YARVARLGLPETGAFLIYKMLTFDPVRRPSADEILNFGMWTV- 334
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap