Conserved Protein Domain Family
PHA03207

?
PHA03207: PHA03207 
serine/threonine kinase US3; Provisional
Statistics
?
PSSM-Id: 165473
View PSSM: PHA03207
Aligned: 4 rows
Threshold Bit Score: 686.192
Threshold Setting Gi: 255683166
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
12084905    1 MEVDVESSKVSASNMGIVCENIESGTTVAEPSMSPDTSNNSFDNEDFRGPEYDVEINTRKSANLDRMESsCREQRAACEL 80 
10834950    1 METNELSSKVSDYNANRPYETIRSDTSDTDPSVSCGTLSDKDGDDEESIDLSKVPNATNVGAGEDCTSP-NDGRTELCRT 79 
125745125  10 MECGISSSKVHDSKTNTTYGIIHNSINGTDTTLF-DTFPDSTDNAEVTGDVDDVKTESSPESQSEDLSPfGNDGNESPET 88 
255683166   2 ETCHTDTLEFDDEVICLGAFAEFDLRGGSDTSDRKNHTGDKFDDCDELFTSDSNTHATDYDGDEESLADqTDVCQSPHEY 81 
12084905   81 RKCSCPTSAVRMQYSILSSLAPGSEGHVYICTRYGDADQKKCIVKAVVGGKNPGREVDILKTISHKSIIKLIHAYKWKNV 160
10834950   80 TSVTGPASVVRMQYNIISPLPPSSEGRVFVCTRWDDVSNKKVIVKVVTGGRDPGREIEIVKTLSHCAIIQLIHAYSWKST 159
125745125  89 VTDIDAVSAVRMQYNIVSSLSPGSEGYIYVCTKRGDNTKRKVIVKAVTGGKTLGSEIDILKKMSHRSIIRLVHAYRWKST 168
255683166  82 TSSSDVAAVVNTQYEILKTLTPGAEGEVFVCVKHGDEQRTPVVVKAGSKGGT-ETEARFLRNINHRAIINAIDAFRNGPL 160
12084905  161 VCMAMRVYRYDLFTYI-DGVGPMPLQQMIYIQRGLLEALAYIHERGIIHRDVKTENIFLDNHENAVLGDFGAACQLGDCI 239
10834950  160 VCMVMRKYKCDLFTYV-DRKESIPLKDVIVIERRLLEALVYLHGKGVIHRDVKTENIFLDYPGNAVLGDFGAACKLDMHD 238
125745125 169 VCMVMPKYKCDLFTYI-DIMGPLPLNQIITIERGLLGALAYIHEKGIIHRDVKTENIFLDKPENVVLGDFGAACKLDEHT 247
255683166 161 VCLVLPHYTHDLYTYVeERSSPLSLETAFTIQKRLLEALSYLHGRGIIHRDVKLENIFLNEPNDAVLGDLGAACKTTASP 240
12084905  240 DTPQCYGWSGTVETNSPELSALDPYCTKTDIWSAGLVLYEMAIKNVPLFSKQVKS--SGSQLRSIIRCMQVHELEFPRND 317
10834950  239 NSPKCYGWAGTMETNSPELLALDPYCAKTDIWSAGLVLFEMSAKKRTLFGKQVKT--SSSQLRALIRCLQIHALEFPQDE 316
125745125 248 DKPKCYGWSGTLETNSPELLALDPYCTKTDIWSAGLVLFEMSVKNITFFGKQVNG--SGSQLRSIIRCLQVHPLEFPQNN 325
255683166 241 YTPQDYGWVGTLEINSPELLALDTYCAKTDIWSAGIVLFEMLVQRVSLFGIKNPSgySSHQLRGIIKAMQVHPAEFPVNG 320
12084905  318 STNLCKHFKQYAVRVRPPYTIPRVIRNGGMPMDVEYVISKMLTFDQEFRPSAKEILNMPLFTKAPINLLNITPSD 392
10834950  317 STTLCKQFKQYAIPLRPPFSIPEVVRRNIPSMDVEYTIAKMLTFDQEFRPSAQDILAFPLFVKEAPQNLQALFVP 391
125745125 326 STNLCKHFKQYAIQLRHPYAIPQIIRKSGMTMDLEYAIAKMLTFDQEFRPSAQDILMLPLFTKEPADALYTITAA 400
255683166 321 NCRIVKEYGKYSEVKRKPYTVPPLIRKYTLHMDAEYLICKMLTFDQQRRPTADDLLSLSVITHKG---------- 385
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap