Conserved Protein Domain Family
PHA03204

?
PHA03204: PHA03204 
uracil DNA glycosylase; Provisional
Statistics
?
PSSM-Id: 165471
View PSSM: PHA03204
Aligned: 3 rows
Threshold Bit Score: 627.758
Threshold Setting Gi: 12084830
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
10834870    2 TSPVMARHGSTDLNETSRTMAAECHAELNQPELKrpaptpSRDSSAAIKKRRRPIGPPPGFAPLGDNAPSPQGETDAYGH 81 
12084830    1 MARVMARCTSIDSSEAPMTTIGDLSAETKHPDLE------MVEGLGRPRKRRRPEGLPPGFIPARTKSDKSCDGGEESSH 74 
125745053   1 ----MAQLDLTGLTETSKMIVGECHVE-----LKrcaeppLAADEPMPKKCRRPAGPPKGFISTRGDTSPSSDNNHIHSI 71 
10834870   82 QLSMTENVRaELWPVIAESYNIDWSWKDWLLPELCCPNGSKLLAEYERRAAVEDVFPPRADIFAWTKYCAPPDVKVVIVG 161
12084830   75 VCNVETESK-KAWEHFSSVYNIDCRWKEILGPELCSPTGTKILAEYERRLRYEEVYPSKSDVFAWTRYCAPDHVKVVIVG 153
125745053  72 QSLTNGDSCvQPWDIIANAYNIHENWKQLLLPELCCLRGSEILAEYERRAITEEVYPPKMDIFAWTRYCAPESVKAVIVG 151
10834870  162 QDPYVHPGQAHGLAFSVKRGITIPPSLQNIFSAVKACYPSIELGAHGCLEDWAKRGVLLLNSVLTVKKGEPGSHHSLGWQ 241
12084830  154 QDPYANEGQAHGLAFSVPPGSPAPPSLKNILAAVRACFPSIEIGSSGCLEDWARRGVLLLNSVLTVKRGDPGSHRAVGWQ 233
125745053 152 QDPYANPGQAHGLAFSVKQGVAIPPSLKNILLAVKACYPSADLGNHGCLEAWSKRGVLLLNSVLTVKRGDPGSHHSVGWQ 231
10834870  242 TLVRNVLRRLSLSTRGIVFMLWGARAQTIYFQTDRDDRHLVLKYSHPSPLSRRPFASCTHFKDANEFLCKSGKGGIDWSI 321
12084830  234 ILVRSVLRKLSQSNAGLVFMLWGAQAQTMYYQNDNDGRHLVLKYSHPSPLSKKPFVHCTHFRDANEFLCKMGKEAIDWSL 313
125745053 232 FFIRNILRRLSSTTRGIVFMLWGAQAQTMYFQTDYDDRHLVLKYSHPSPLSRKPFATCTHFKEANDFLSKIGRGCIDWSL 311
10834870  322 GA 323
12084830  314 TA 315
125745053 312 TA 313
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap