Conserved Protein Domain Family
PHA03202

?
PHA03202: PHA03202 
uracil DNA glycosylase; Provisional
Statistics
?
PSSM-Id: 165469
View PSSM: PHA03202
Aligned: 3 rows
Threshold Bit Score: 679.495
Threshold Setting Gi: 9629790
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
9629790     1 MSSACDLKTKlSTTADIIETKPVEKQQRLPIPTSKASqTVCKESPKECESGAPPQKRKRPCGLPPGVSLINTGVSTHPLL 80 
50313302    1 MSSACDHETE-ASHVNIPETTPEENGSNSSTPTSEIG-PACVVSPAPGETGAPPPKRRRPCGLPQGVALINTSVSTHPLF 78 
261835098   1 MSSTCYHDTN-ASPVNIPNTSPEENGLKSSTPTSEPGrPACVVSPAPCETGAPPPKRRRPCGLPQGVTLINTSVSTHPLF 79 
9629790    81 TNNLQSSWEEIELEFNIAPSWRPILEKEMQQQYVKLLLGEYKLRCAREEVFPKKEDIFAWTRFAPPEKVRVVIVGQDPYH 160
50313302   79 TTSCQSSWEDVEREFNIAPSWRPILEREMQQPYVRLLLNEYKLRCASEEVFPPKEDIFAWTRFSPPEKVRVVIVGQDPYH 158
261835098  80 TTNCHSSWEDVEREFNIAPSWRPILEREMQQPYVRLLLNEYKLRCSNEEVFPPKEDIFAWTRFSPPEKVRVVIVGQDPYH 159
9629790   161 APGQAHGLAFSVQKGVPVPPNLRNIYSAVQKSYPAFRPPTHGFLDKWASQGVLLINTTLTVTRGQPGSHATLGWHRLVRA 240
50313302  159 APGQAHGLAFSVRKGVPVPPSLRNIYSAVQKSYPSFRHPMHGFLERWAEQGVLLINTTLTVARGKPGSHATLGWHRLVRA 238
261835098 160 APGQAHGLAFSVRKGVPVPPSLRNIYSAVQKSYPSFRPPMHGFLEKWAEQGVLLINTTLTVARGKPGSHATLGWHRLVRA 239
9629790   241 VIDRLCATSQGLVFMLWGAHAQKFCSPSRQHHLVLTYGHPSPLSRVNFRDCPHFLEANAYLAKAGKSPINWLIE 314
50313302  239 VIDRLCTTSQGLVFMLWGAHAQKSCSPNRQHHLVLTYGHPSPLSRVNFRDCPHFLEANAYLTKTGRKPVDWQIE 312
261835098 240 VIDRLCTTSQGLVFMLWGAHAQKSCSPNKQHHLVLTYGHPSPLSRVNFSDCPHFLEANAYLTKTGRKPVDWQIE 313
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap