Conserved Protein Domain Family
PHA03201

?
PHA03201: PHA03201 
uracil DNA glycosylase; Provisional
Statistics
?
PSSM-Id: 165468
View PSSM: PHA03201
Aligned: 5 rows
Threshold Bit Score: 496.723
Threshold Setting Gi: 155042206
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
9629382     1 MKRACSRSPSPRRRPSSPRRTPPRdgtppqkadaddpTPGASNDASTETRPGSGGEPAACRSSGPAALLAALEAGPAGVT 80 
155042206   1 MKRPRSPSPPPPRPLPPPRPDALQ-------------SPDGSPEETPPSPPVPGAEAPPGAAGGPAAPRRRPRGCPAGVT 67 
155041491   1 MKRARSRSPSPPSRPSSPFRTPPHggsprrevgagilASDATSHVCIASHPGSGAGQPTRLAAGSAVQRRRPRGCPPGVM 80 
155041492   1 MKRPRSPSPPPPPPPPPPRPAAIA-------------SPDRSPEETPPSPPVPGAEPPPGTTGPRAAPRRRPRGCPAGVT 67 
155041721   1 MKRARSRSPSP-QRPLPPRPDGPT-------------SPRGNPEETRPGPPAPAHESPREGTATRPAARRRPRGCPAGVT 66 
9629382    81 FSSSAPPDPPMDLTNggvSPAATSAPLDWTTFRRVFLIDDAWRPLMEPELANPLTAHLLAEYNRRCQTEEVLPPREDVFS 160
155042206  68 FGAPAPAAPALGLGD---APAACPLPLDWPEFRRRFLVGDAWRPLLEPELANPLTARLMAEYERRCRAEEVLPPREDVFS 144
155041491  81 FSASTTPEQPLGLSGdatPPLPTSVPLDWAAFRRAFLIDDAWRPLLEPELANPLTARLLAEYDRRCQTEEVLPPREDVFS 160
155041492  68 FDS--PARPALGLDD---TPAGRPPSLDWPEFRRRFLVGDAWRPLLEPELANPLTARLMAEYERRCRAEEVLPPREDVFS 142
155041721  67 FDSQPPSRPSLGLDD---AHADRPPALDWTGFRRRFLVGEAWRPVLEPELSNPLTAQLMAEYERRCRVEEVLPPREDVFS 143
9629382   161 WTRYCTPDEVRVVIIGQDPYHHPGQAHGLAFSVRANVPPPPSLRNVLAAVKNCYPEARMSGHGCLEKWARDGVLLLNTTL 240
155042206 145 WTRYCAPDEVRVVIIGQDPYHQPGQAHGLAFSVRPGTPAPPSLRNILAAVRNCCPDATMSGQGCLEKWARGGVLLLNTTL 224
155041491 161 WTRYCTPDDVRVVIIGQDPYHHPGQAHGLAFSVRADVPVPPSLRNVLAAVKNCYPDARMSGRGCLEKWARDGVLLLNTTL 240
155041492 143 WTRYCTPDEVRVVIIGQDPYHQPGQAHGLAFSVRPGTPAPPSLRNILTAVRNCCPEATMSGHGCLEKWARGGVLLLNTTL 222
155041721 144 WTRFCTPDEVRVVIIGQDPYHQPGQAHGLAFSVRPGTPTPPSLRNILAAVRNCCPDAELAAHGCLEKWARGGVLLLNTTL 223
9629382   241 TVKRGAAASHSRIGWDRFVGGVIRRLAARRPGLVFMLWGTHAQNAIRPDPRVHCVLKFSHPSPLSKVPFGTCQHFLVANR 320
155042206 225 TVRRGEPASHAKIGWDRFVASVLRRLAASRPGLVFMLWGAHAQSAIRPDPRVHRVLTYSHPSPLSRVPFGSCRHFCLANQ 304
155041491 241 TVKRGAAASHSKLGWDRFVGGVVQRLAARRPGLVFMLWGAHAQNAIRPDPRQHYVLKFSHPSPLSKVPFGTCQHFLAANR 320
155041492 223 TVRRGEPASHAQIGWDRFVGSVVRRLAASRPGLVFMLWGAHAQSAIRPDPRVHRVLTYAHPSPLSRVPFGSCRHFCLANQ 302
155041721 224 TVRRGEPASHAKMGWDRFVASAVRRLAASRPGLVFMLWGAHAQNAIRPDPRVHRVLTYSHPSPLSKVPFSSCRHFCLANQ 303
9629382   321 YLETRSISPIDWSV 334
155042206 305 YLRERSLAPIDWST 318
155041491 321 YLETRDIMPIDWSV 334
155041492 303 YLRERSLAPIDWST 316
155041721 304 YLRERSLAPVDWST 317
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap