Conserved Protein Domain Family
PHA03200

?
PHA03200: PHA03200 
uracil DNA glycosylase; Provisional
Statistics
?
PSSM-Id: 165467
View PSSM: PHA03200
Aligned: 9 rows
Threshold Bit Score: 472.29
Threshold Setting Gi: 14251103
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
61660218   1 MALRQWMLRHIAVHDVGAAAAGADvsadvihQQAEALGIHEAWMSFLKLSATQASQLVRITDRVDQERRM-CTIYPEKSD 79 
9845402    1 MALRRWLLENVAVYDIQHVDEALTdy----tDYAERLGIEESWLRFMKPTPRQISQLLQITDKVDRERRL-ITIYPPKED 75 
9628383    1 MALLQWMLDHVQDEEKNCENLSID-------DQHSLFGINRDWLSFLQLSKLEITHLKHVYKLVDNDRAH-LMVHPSSDN 72 
9633150    1 MALLQWMLDHVQDEEKNYENLSID-------DQHSLFGINRDWLSFLQLSKLEITHLKHVYKLVDNDRVH-LTVHPSSDN 72 
14251103   1 MALRAWMLANIPDEQRPTATEPPE-------DQALWLEMDLRWVRFLRLSRFELDHLRRIVDAVRRDRERgHTVYPAPED 73 
20026696   1 MALREWMLANIADNKGCMLN--PD-------EQARVFCLSADWVRFLSLPEHDTALLRETVAAVESARQR-GVVYPPPEH 70 
51556602   1 MALKQWMLENIPDNKACMLN--HD-------EQTRLLSVSKEWLVFLNIPSHDLDLLRDTVDAVARARQS-DTVYPPPEH 70 
51874301   1 MALLQWMLENISDDNSIKMS--LE-------EQHETFQINVKWLKFLNLSDSDIVQLQNVYKLVQRDRER-LIIYPDPQN 70 
52139279   1 MALKQWMLANIADNKGSLLT--PD-------EQARVFCLSADWIRFLSLPDHDTVLLRDTVAAVEGARQL-EMVYPAPEH 70 
61660218  80 VHRWSRLCFPYDVRVVILGQDPYHDGSACGLAFGTVRDRPAPPSLVTVFKELRRSIPEFSMPKCGCLDAWCREGVLLINT 159
9845402   76 VHRWSRLCNSGSVKVVIIGQDPYHDGSACGIAFGTTRDRHAPPSLVTVFRELNRTVPNFRIPDSGCLDGWCRQGVLLINT 155
9628383   73 VHAWSFLCKPDNVKVVILGQDPYPDGRGCGLAFGTVKECSIPESLKNIFKELERSVPNFSPPDNGCLNSWCSEGVLLLNS 152
9633150   73 VHAWSFLCKPTDVKVVILGQDPYPDGRGCGLAFGTVKECSIPESLKNIFKELERSIPNFSPPDNGCLNSWCREGVLLLNS 152
14251103  74 VHRWSRLCGPEDVHVVIIGQDPYHDGSANGLAFATTGDR-IPPSLRNIFKELVRSVPGFEMPGSGCLDGWCEQGVLLLNS 152
20026696  71 VHRWSFLCSPERVRVVIVGQDPYCDGSASGLAFGTMMGKPPPPSLNNVFREVARTVDGFRRPTWGCLDAWCQRGVLLLNT 150
51556602  71 VHRWSYLCAPDNVYVVIVGQDPYCDGSASGVAFGTLPGQVAPPSLQNVYRELCRTVAGFQRPIGGCIDDWCRRGVLLLNT 150
51874301  71 VHSWSYLCSPEEIKVIIVGQDPYPDGRGHGLAFSTVRGCSPPNSLKTIFAELERTIENFKAPAHGSLKSWCAQGVLLLNT 150
52139279  71 VHRWSYLCPPEQVRVVIVGQDPYCDGSASGLAFGTLAGRPPPPSLNNVFRELARTVDGFQRPASGCLDAWARRGVLLLNT 150
61660218 160 VFTVVKGQPGSHEALGWQILSDRVLQALSEQREGLVFLLWGLQAQKKEYLIDPRKHLILRSSHPSPRAQGARNPFVGNNH 239
9845402  156 VFTVIKDRPGSHNDLGWQMLSDRAVQALSEKRDGLVFMLWGLQAQKKEYLIDSTKHLILKSSHPSPRAQGAKNPFIGNNH 235
9628383  153 IFTVVHGLPMSHEAFGWQTLSYKIISKLSVEMDSLVFLLWGNHARKLSYLIDARKHLVLESAHPSPKVKSARMPFIGCNH 232
9633150  153 IFTVVHGLPMSHEAFGWQTLSYKIISRLSEQMNSLVFLLWGKHARKLSYLIDAQKHLVLESAHPSPKVKSARMPFIGCNH 232
14251103 153 VFTVLRGRPGSHEHLGWQTLCDALIRQLSERREHLVFMLWGKLAQEKEYLIHPTRHLILRSCHPSPRV--TSTSFVGNDH 230
20026696 151 VFTVVHGQPGSHRHLGWQTLSGRVIRRLSELREHLVFMLWGAEAQSCEYLIDRRRHLVLKACHPSPKN--TSKSFVGNDH 228
51556602 151 VFTVVRGQPGSHRHLGWQVLSERVISRLSECREHLVFMLWGAEAQTLECLINKSRHLILKAWHPSPK---NTKSFLGNEH 227
51874301 151 VFTVIRGVPMSHEAIGWQVLSNRIINQLSEKMQNLVFMLWGSQARKLVSLIDSKKHLILECAHPSPRTKGSKTPFIGCGH 230
52139279 151 VFTVVHGQPGSHRHLGWQTLSNHVIRRLSERREHLVFMLWGADAHTCEYLIDRRRHLVLKSCHPSPRN--TTRAFVGNDH 228
61660218 240 FVLANEYLSRRGER-VDWNVLCS 261
9845402  236 FVLANEYLSRQGSR-VDWNVLSG 257
9628383  233 FVRANLFLTEHGKDpINWNILNE 255
9633150  233 FVRTNLFLTEHGKDpINWNILNE 255
14251103 231 FRRANEYLLTHGSPaIRWQQLTG 253
20026696 229 FVLANAYLDTHYQEtIDWRLDS- 250
51556602 228 FVLANEYLRKHHEKtIDWRL--- 247
51874301 231 FLKANKYLQIHNKCpIDWNITND 253
52139279 229 FILANAYLDTHYREtMDWRLCG- 250
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap