Conserved Protein Domain Family
PHA03199

?
PHA03199: PHA03199 
uracil DNA glycosylase; Provisional
Statistics
?
PSSM-Id: 165466
View PSSM: PHA03199
Aligned: 2 rows
Threshold Bit Score: 618.559
Threshold Setting Gi: 13242453
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
9625933    1 MDVSGEPTVCSNAYANEMKLSDSKDIYVLAHPVTKKTRKRPRGLPLGVKLDPPTFKLNNMShhydTETFTPVSSQLDSVE 80 
13242453   1 MCFRCTKRISASVFERKRNMAKRCSSTNTENVTRPQKRFRPCGIPPGVILNVDCQQLKDQP----TETLWCEQNVANTTS 76 
9625933   81 VFSKFNISPEWYDLLSDELKEPYAKGIFLEYNRLLNSGEEILPSTGDIFAWTRFCGPQSIRVVIIGQDPYPTAGHAHGLA 160
13242453  77 LLDEFCVDPEWHSLLRVEFEKPYVRHIFEQYRQRVNNGEEIFPIKKDIFAWTRFCPPEKVRVVILGQDPYHGPGQAHGLA 156
9625933  161 FSVKRGITPPSSLKNIFAALMESYPNMTPPTHGCLESWARQGVLLLNTTLTVRRGTPGSHVYLGWGRLVQRVLQRLCENR 240
13242453 157 FSVTRGTPIPPSLKNIFLAVRESYPHLPLPTHGCLDNWARQGVLLLNTTLTVKRGVPGSHFYMGWDMLIKSMLKTLCLQR 236
9625933  241 TGLVFMLWGAHAQKTTQPNSRCHLVLTHAHPSPLSRVPFRNCRHFVQANEYFTRKGEPEIDWSV 304
13242453 237 TGLVFMLWGVNAQRTIQPNPSEHLVLTYGHPSPLSRSEFRVCKHFLQANNYFLKRGEPIINWTI 300
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap