Conserved Protein Domain Family
PHA03195

?
PHA03195: PHA03195 
tegument protein VP11/12; Provisional
Statistics
?
PSSM-Id: 177556
View PSSM: PHA03195
Aligned: 4 rows
Threshold Bit Score: 1163.24
Threshold Setting Gi: 281190772
Created: 9-Dec-2010
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
50313255    1 MDGGGSSSWTHVSKNLIERRAVKGCLLPTPSDVMDAAVMALKDVTENIVGQQLFSVDRTNALSVIHTNEVPESIIATAIA 80 
9629738     1 MEASGSASWARVSKNLIERRAVKGCLLPTPSDVMDAAVMALKDATENVVSKHLFSVDRTNALSVIHTNAVPESIITTAIL 80 
216905867   1 MDGGGSSSWTHVSKNLIERRAVKGCLLPTPSDVMDAAVMALKDVTESVVGQQLFSVDRTNALSVIHTNEVPESIIATAIA 80 
281190772  21 NSSRDVSSWVGVAENLLERRVEKGCMLPTPAEILESAVSALKESAENLSGPGLFCMERVTALSRIRDNTIPETIITTCMG 100
50313255   81 RDTSRDYLREYEGAAKCNLAATDLSHDEMWEVVIKRYWRYLRESSGAEVVDRGAVGQATQSVLSVLLLQSTFGKKRLSKN 160
9629738    81 RDTNGEYRREYEDSAKCNLAATDLSQDGMWEVVIKSYWRYLRESSGAEVVDRGGVGNTTQSVLSVLILQSTFGKKRLSKN 160
216905867  81 RDTSSEYLREYESAAKCNLAATDLSQDEMWEVVIKSYWRYLRESSGAEVVDRGAVGQATQSVLSVLLLQSTFGKKRLSKN 160
281190772 101 KDNGEEFRRGYIMAARRVIEGLNMTRAGIWQIMIKNYWTYLKTSSGTDM----TVDSRTPSSLKVMLLWSTFSGKRLSKQ 176
50313255  161 PFKHKGPNVGYKSNLEDLRSAFTKIEKYMYYMRPNDPMTKSEDTELRLHELLAYVTTCYRWLLWFMDLTDAKVLRNIDKG 240
9629738   161 PFKHKGPNVSYKSNLENLRAAFTKIEKYMYYMRPNDPMTKSEDTELRLHELLAYVATCYRWLLWFMDLTDAKVLKNIDKG 240
216905867 161 PFKHKGPNVGYKSNLEDLRSAFTKIEKYMYYMRPNDPMTKSEDTELRLHELLAYVATCYRWLLWFMDLTDAKVLRNIDKG 240
281190772 177 PFKHSKQNDNHEALISELKRVMITLEKYAYYMRPDDPMSKSTDTMLRLHEILAYVSVSYRWLLWFMDLLDNRVLCAMDKK 256
50313255  241 PVITHGPRESRPPDELVRRHLKSGPAISAGTGVALTLSTATADALIVLLRMSVSWTSHSWKSNTHGVTGAIVAAVELVTL 320
9629738   241 PVITHGPRETRPPDELVRRHLKSGPAISAGTGDALTLSTATADALIVLLRMSVSWTSHSWKSNTHGVTGAIVAAVELVTL 320
216905867 241 PVITHGPRESRPPDELVRRHLKSGPAISAGTGVALTLSTATADALIVLLRMSVSWTSHSWKSNTHGVTGAIVAAVELVTL 320
281190772 257 PIIRHGPRESQSPRDFIQRHLTSGPGISSGTGEALLLSAETANALATLLRISSMWSYGKWSTHTHGVTSTIVAALEMVTQ 336
50313255  321 IHHHLQYIINTVFAGYVCWLDGGVENSYLNSALRSQGRFDHFVGKLVPIMATLSWANMEKGTVMWFKYALAKSIVCHGSP 400
9629738   321 IHHHLQYIINTIFAGYVCWLDGGVENSYLNSALRNQGRFDHFAGKLVPIMATLSWANMEKGTVMWFKYALAKSIVCHGSP 400
216905867 321 IHHHLQYIINTVFAGYVCWLDGGVENSYLNSALRSQGRFDHFVGKLVPIMATLSWANMEKGTAMWFKYALAKSIVCHGSP 400
281190772 337 IHLHLQYFINLVFGGYMCWAEGGMEDSYIRSALRLQGRFNHYIGAVIPVMSALTWSGMEKSVSCWFKYSLAKSLIGHVTP 416
50313255  401 TQHYLTVLESIASKRTGACPPQGSTFGRNpSGFPGQFCCPPQGPLPAPPNSKTRGTFRRC-----RPGSLRSSRQLPTSP 475
9629738   401 TQHYLTVLDSIASKRTGAGLPPGATFGRT-ANFQGQFGCPPQGPLPAPPNSKTKSMFKRP-----GRGSVRSLKQLPAST 474
216905867 401 TQYYLTVLESIASKRTGSCPPQGATFGRNpAGFPGQFCCPPQGPLPAPPNSKTRGTFRRC-----RPGSVRGSRQMPNSP 475
281190772 417 TQHYLGILGSIERGRRRSTRERAKTERRCvSQMMTHIDRQSL-PLPSPPTPHAHHDVTYPpavitPPNPYMGMASLLASP 495
50313255  476 --PsNIVSPRTNPAIEGSTAAKNVQGAETIQVRSSGEFNDCIWYINGAYPHQRSDSSSSDNSTCSSTETQYITLPSTPSP 553
9629738   475 --P-NMVSSATTYNAGGNTAATSGQGEEAIQIHASGELNDCIWYLNGTYSHQRSDSSSSDNSSCSSTETEYITISSTPSP 551
216905867 476 --PsNIVSPRTNPAVEGSTAAKNGQGAETIQVRSSGEFNDCIWYINGAYPHQRSDSSSSDNSTCSSTETQYITLPSTPSP 553
281190772 496 ltPrDISSPGL-----GDHPSNTPDGVEGCFHRTPLRSDARTKQLDDRF----------DSSDCDG--TPYTSLDDIRPE 558
50313255  554 TGDVVYTNPLLGPDEEVDASPQPVDPMSDYSAPKNP---DYMRPRSTLVEEVWQLRDS---------DYTPYMRPSRAGR 621
9629738   552 TREVVYTDPLLGSDEEKDASPQPANTVSEYSSPANS---GYMRPRSTLAEEIWQLRDS---------DYTPYMRPSRAGR 619
216905867 554 TGDVVYTDPLLGPDEEVDASPQPVDPVSDYSAPKNP---DYMRPRSTLVEEIWQLRDS---------DYTPYMRPSRAGR 621
281190772 559 ESEDHINNPSYGLTETFNSS-----NLSNGDEPRDAyqtHYQHPRCISPEDTAQSRGSsasgttsqlQYTEHYQT----- 628
50313255  622 SRVRVEDQTLEpsSPAGCNPPANSPENDSDDAAVDSPPISP--EVVYGTFRPRAKCVYDQYGLTALAALSASRAKARRTR 699
9629738   620 PRLRLEDQTLQ--TLPGCKPPANSPEDNFEDTLFSSSQIYS--DNAHSTFRPRARCVDDEYGLTALAALSASQAKARRVR 695
216905867 622 PRVRVEDKTLEp-SPDGCTPPANSPENNAAASV-DSPPISP--EVVYGTFRPRAKCVYDQYGLTALAALSASRAKARRTR 697
281190772 629 PICHKKCQCSKpgGPKGDYPELYNECGDVKKNLPRRRSSSPgiEEVVERFRPRSRLLDDTYGIETLATLNASSIK----- 703
50313255  700 PGPTqPDVCRERDEESAEPRHDGFIRRTMSTTGPPRKHPDQTERVSSL 747
9629738   696 LGTTtPTSANEATEKYTTPSSGGCIRRTLSTSESPESSPEQQERVSSL 743
216905867 698 HGPT-PQDVDKRAEESAALRNDSFIRRTMSTTGPPRKHPEQTERVSSL 744
281190772 704 -------------------RAHGTSRVDFQTHAIRK------------ 720
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap