Conserved Protein Domain Family
PHA03193

?
PHA03193: PHA03193 
tegument protein VP11/12; Provisional
Statistics
?
PSSM-Id: 177555
View PSSM: PHA03193
Aligned: 2 rows
Threshold Bit Score: 1082.44
Threshold Setting Gi: 125745098
Created: 9-Dec-2010
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
10834917    1 MDRYACASMSPELFTPTSPepetdslalnsrsrgsptrvQEYPCQLSETTGTSLSGIRAQEDALVEVLPSGFLSALRQTL 80 
125745098   1 MKRLSSSEQSLELFDRDSP--------------------QEYSCILPNELTVSASALRALEDSLIEKLPSGLTLGIRESV 60 
10834917   81 LRDAPSNKVPECIVVYLALGDASEEYTRPYRARIARRMKKKKLTRASVKRCYQASYMNYLEMRRDGCRAGSPETCDPTRR 160
125745098  61 LCETLSNKVPESVIVHLALGDVRGEYISLYSANVKRRLKRAALTPAVVKDYYTDSYQRYVCKRRRIPCVDLPGTREPARS 140
10834917  161 EAALLFYPIINRNALVKKPFQLAKDNALYLRCWREIRDGTELIQKYAYYMRPDDVTAPSADTSIRLQLLLSYVRTLYTWA 240
125745098 141 TVALLFYPAIQRNPLTQKPFRLQKDNKMFVKCWAEIWDALNFIQKYVYYMRPDEITTPSLDTSARLELLFGYVKTLYMWA 220
10834917  241 VWLMDVLDLRACPNVFGPRAPSDFDTVFLALAEAVSSLPSESWADTTMLCHFIGTVLAPLVHMGALWTCCAWRSSPESEV 320
125745098 221 MWLMDLLDTRIVSNKFGTRVPISIDNIFSNLTEVMGSLSSDKWMSTALLCRSIEHLLSSLIHISSLWTCCQWRETKHGEM 300
10834917  321 SRPVVAIVALVGLLNYRCQYILNMVFNGYAVWLQGGMANSTLRRALRQQKRFQCFLGELFPTMNSCTWADTESTVALWFK 400
125745098 301 LRPIVSIVALVSLLHHHCQYIINITFNGYARWLEGGLGNPMLRSAIRQQKRFEHYLGGLFPSIRPTAWGELEFSIRAWFE 380
10834917  401 HARVKSTVTY--------------QPAAKGGDSVVRCLQDSPQQSKRAWVEDGGETSEAPASNGQSIFTMHFTQDSPPPA 466
125745098 381 LALAKSMVIHgsllkksivsnnvlEPLCKPRHTQIGERHDTRFTRSTSMPSSSGHIHSTLQNNQQAIVPECSSGQLSSIA 460
10834917  467 QCSLTYLRSPTPTTastsnGTRTDAEPSPASDRAATLPATFSIERNGCASTTGLAIPADMCNAVAVGSPSTVPETPPErL 546
125745098 461 TALWSADELQNDYV-----EMKGGVLCPAPQPADSITPNSSQTNNGTASDGSPTRVTDASLDPTEVESSTTVAETPPV-T 534
10834917  547 LEAPTGPRPKAVRKHRGGTVTVTEILRRLTMTSD 580
125745098 535 VAVESVYVCRETARNKSPSSKVERILRRLRVATD 568
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap