Conserved Protein Domain Family
PHA03191

?
PHA03191: PHA03191 
UL14 tegument protein; Provisional
Statistics
?
PSSM-Id: 165461
View PSSM: PHA03191
Aligned: 3 rows
Threshold Bit Score: 346.25
Threshold Setting Gi: 10834883
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
125745065   1 MFAVSAMRRRRRRILAECRTREAVYKERTLELLSQGVETDDPEFIEVFTSARNAHSDYKAQLRSNMRLEATDRKTKIIQR 80 
12084842    1 MFAAAAMRRRRRQLLAECRVRETIYKERTLELLSEGVGTDDPAFIATFTSARNAHTDHKAQLRSNILLENTERKLRLIER 80 
10834883    1 MFAVNTIRRRRRQILAECRTREKIYKERTLTLLSQGVEADDPELIEALTSARNAHSDYKTQLHSNMRIEEAHRKSRIIQR 80 
125745065  81 HIDEQLDRRLILDINRKLLNPKLQLQLDQTEEAILEKEDILAQTIDDITLNDSITNTDELDEESEALLTKWILNQKTKKR 160
12084842   81 RIEDQVDRKLILETNRRFLSPELHSHLEQAEEDLIDKETILTEACEELTLADSSEDIEEFSETAEALLTKWILEQKPRPL 160
10834883   81 HIDEQVDRRIVLDANRRFLNPRLQSQLDRAEEDILANEDILTQISDDIS--DRLPDI-ELDAECEALLSKWILTSKPESR 157
125745065 161 PTVAKTAIAPTAHGLQTKVSRNVFITGKDDLVQPTDLGQPSTHEVITCTSRErIIHPDGIHTEIYTTEDVSPTILDDV 238
12084842  161 LPTKSAAPPHARDGTRMTEKARVPTGVQTTNSQATDQNLPPPTTSTPSISKQ-VIHRNALSPEVDAVEDASRATLGDV 237
10834883  158 GAAAKTTSVLTLNGFPTSATKKTSAGLRDTQAQQT-------------ICREhSVPPEEIRVEKRTTNNTSPSTLGDA 222
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap