Conserved Protein Domain Family
PHA03190

?
PHA03190: PHA03190 
UL14 tegument protein; Provisional
Statistics
?
PSSM-Id: 165460
View PSSM: PHA03190
Aligned: 2 rows
Threshold Bit Score: 322.428
Threshold Setting Gi: 148828634
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
148828634   1 MSSARDYRNRARAEVMNYIKGQAYKAAVIEMMSLKVPRMHPALRYFLASAREQEAVSEINVRSNKRLSSVRCHVARIKAA 80 
38638243    9 RDTRRERRIQARTKIMEYIKGSAYKASVLEMTSAGVSPSHPAFRHAFTKATEHEEAAKIAAQVDKRMVSVRRKIARITAV 88 
148828634  81 TESQRALRLELDGYRRYLRNDFLETFAQESEAIADAELDLQRAEEEIALYISGDPDrrdsLDCEEDDLLLKWQLENVNPP 160
38638243   89 VNGQRELASELKGYRRYLSSGFLDTFAAEADKLYEDEISLECAEAELSQHLPAGED----YDEGENELLVRWQLEGAPVP 164
148828634 161 TLLPSPHAPSPVSRGNSPRTPPTPSptfqEDECPVE 196
38638243  165 SRSPITPYRTGESSGVSPKSPQGPS----DATCVRQ 196
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap