Conserved Protein Domain Family
PHA03188

?
PHA03188: PHA03188 
UL14 tegument protein; Provisional
Statistics
?
PSSM-Id: 165458
View PSSM: PHA03188
Aligned: 2 rows
Threshold Bit Score: 366.31
Threshold Setting Gi: 9625920
Created: 9-Dec-2010
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
13242439   1 MSGTTQLSIANRRTRVHLLEAHHRANLYKQRTTDLIRGGSTTSDPHFVHAFTTAKDACAELNRNIRSVARVTAVEQKIAK 80 
9625920    1 MSGHTPTYASHRRNRVKLVEAHNRAGLFKERTLDLIRGGASVQDPAFVYAFTAAKEACADLNNQLRSAARIASVEQKIRD 80 
13242439  81 IQERVKEQTTIRKLLNANRRYLAPNFVERLENIEDDNCEGIDKLEDAVGGDTPLDHQEgWLCEDDEALLTQWMLTTSPsp 160
9625920   81 IQSKVEEQTSIQQILNTNRRYIAPDFIRGLDKTEDDNTDNIDRLEDAVGPNIEHENHT-WFGEDDEALLTQWMLTTHP-- 157
13242439 161 iphaPPTQNTLVEECLTCSTMNVQKNDMKNAMTNIHQMT 199
9625920  158 ----PTSKYLQLQDLCVPTTIPTDMNQMQPQPISKNENP 192
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap