Conserved Protein Domain Family
PHA03185

?
PHA03185: PHA03185 
UL14 tegument protein; Provisional
Statistics
?
PSSM-Id: 177553
View PSSM: PHA03185
Aligned: 5 rows
Threshold Bit Score: 325.441
Threshold Setting Gi: 83722582
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
9629394    1 MDRDAAHAALRRRLAETHLRAEIYKDQTLQLHREGVSTQDPRFVGAFMAAKAAHLELEARLKSRARLEMMRQRATCVKIR 80 
9629283    1 MSRDASHAALRRRLAETHLRAEVYRDQTLQLHREGVSTQDPRFVGAFMAAKAAHLELEARLKSRARLEMMRQRATCVKIR 80 
30984442   1 MDRGPGRAALRRRLAETHLRAEVYREETLRLHREGVGTQDPRFVSAFMAAKAAHRELEARLRSRARLEVLRQHAACVKIR 80 
83722582   1 MDRGPGRAALRRRLAETHLRAEVYREETLRLHREGVGTQDPRFVGAFMAAKAAHRELEARLKSRARLEVLRQHAACVKIR 80 
56694736   1 MDRGPGRAALRRRLAETHLRAAVYREETLRLHREGVGTQDPRFVGAFMAAKAAHRELEARLKSRARLEMLRQHAACVKIR 80 
9629394   81 VEEQAARRDFLTAHRRYLDPALGERLDAVDDRLADQEEQLEEAATNASLW-GDGDL-AEGWMSPADSDLLVMWQLTSAPK 158
9629283   81 VEEQAARRDFLTAHRRYLDPALSERLDAADDRLADQEEQLEEAAANASLW-GDGDL-ADGWMSPGDSDLLVMWQLTSAPK 158
30984442  81 VEEQAERRDFLIAHRRFLDPALGERLDEVEDRLADQEEQLEEAAANACLLsGDCDP-TDGWMSSEDSDLLIMWQLGSAPA 159
83722582  81 VDEQAERRDLLIAHRRYLDPAFGERLDEAEDRLADQEEQLEEAAANACLLsGDDDPaADGWMSAEDSDLLIMWQLGSAPA 160
56694736  81 VDEQAERRDLLIAHRRYLDPAFGERLDEAEDRLADQEEQLEEAAANACLLsGDGDP-EDGWMSAEDSDLLIMWQLGSAPA 159
9629394  159 VHANGPSRIGSHPTYTPTPTGPPGApAAPLSRTPPSPAPptgpaTDPASASGFARDYPDGE 219
9629283  159 VHTDAPSRPGSRPTYTPSAAGRPDAqAAPPPETAPSPEPapgpaADPASGSGFARDCPDGE 219
30984442 160 VRPGDLSGLGSRPTSGPVAGGLPGG-GAPGLPDRARPGP-----TDPASESDCGSDSRNGD 214
83722582 161 VRPGDLSGPGSRPTSGPVAGGLPGG-GAPAPPGPGRPGP-----TDPASESDCGSGSRGGD 215
56694736 160 VRPGDLSGPGSRPTSGPVAGGLPGG-GAPAPPSRDRPGP-----TDPASESDCGPGSRGGD 214
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap