Conserved Protein Domain Family
PHA03181

?
PHA03181: PHA03181 
helicase-primase primase subunit; Provisional
Statistics
?
PSSM-Id: 165452
View PSSM: PHA03181
Aligned: 3 rows
Threshold Bit Score: 1510.59
Threshold Setting Gi: 12084836
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
10834877    1 MSTMAEANTVAVQKIRGCICYTTLYRVWTSRDRTDGLTALCYLLFRNECGTYSAHYSTVNVSGRSIARAWGLNPDSVTDA 80 
125745059   6 STMAASSKTNMMQIMRGCICYTTVYRIWTNKNRTEGLTALCYLLFRNTCGQYSAQYSTVNLSGKSMAKLWGLNPDMITDT 85 
12084836    1 ------MNDISAVELQGCICYATLYRLWTSSNHDEGLTALCYLLFRDVDGNYAAHYATVNFSGKSLAKAWGWNPETITDA 74 
10834877   81 ALAIMASAGSVTGVWPSCRPDQHALWKALLAVTLAKLRIKLGYHAYFAPVDMYVDTTTGLVISCEPLPGDRCAPRPGLLK 160
125745059  86 MLAGMTNSASVTGLWPSCPSDQHMLWKALLTTTLAKLRHRLGYHAYYTPVTIYIDSQTGLVTACEPVSGERSIPRPGLLK 165
12084836   75 TLASMANAAATNDRLPFLNADQNTLWKALLAFTLSNLRHRLGYNAYYTPINMHVDKITGLVLSCTPLNSEHYKPRPGLLK 154
10834877  161 TDGAVHVEESRLVSTAMEYTEGAHLAHIKLSALKHDDTIPEFDSRIEIYTKEDRFIREYKTVGRRSKKIKW-GNTNRIFT 239
125745059 166 TDGMISVEESCLISTAMKHAEGAPLAHIKLSALKRTRQIPEFDMRIEIQTKEERFLREYKKVNSPYKKFKCdNNSNTIFK 245
12084836  155 TDGTINIDESSLLSAAMKFTNGTTLARVKLSAMSNIE-LADFDAKIEIQTKNDIFYREYTSRSSRTKKTKL-HVSDNAFH 232
10834877  240 IVERVLSLPDSQAPIKTAAPVPTSFDCLVTTPAEFSLTALLAIYAQWHKKIYSLADDSEKRLAPIFVYIGPETSPRGEDV 319
125745059 246 VVDNTLVLDHLQPPVRALSLVPTSFDCLVTTPAEFSLVALLATYAKWHEKLYSCDNESTNILVPILMYIGPETNPRGEDV 325
12084836  233 VAEKPLIIDG--ASVRTLTLVPASFDILVTTPSEFSLSALMIIYTKWRETLFSTAGGPEKILTPIFTYIGPETNPEGEDL 310
10834877  320 DYACTIGFPLWPLLKTSTAAPSAIRKAVGSYSETDGLWPLAGPRTFHLLAPWHPETHPTPGIDVLENLKGRTSSTRRQVA 399
125745059 326 DYSCIIGFPGWPIVKSSTANQTAIKDAIDAYVDTDGLWPLAGPRTFHLLAPWSPENHPFPMIDTSHILSVHSTDIRHKAA 405
12084836  311 DYACIVGFPGWPMVKSSTASHLAIKEVIDSYAATDGLWPMAGARTFHLLAPWRPDNHPSPTIDICHYL-AESNVAQGRIA 389
10834877  400 DDWTAGRITCIFREPTFIEQAYIAKFDFSAFFATLYLGLFPDHSRLRAAVKARLQREKNWLKQPIIEFGGLLKRVREDVY 479
125745059 406 DEWTTGRITCILRDPTLIENAAIAKFDFSAFFATLYLGLFPTHSRLHDVVKARLKREKPWLKRPILEFGGLLKKLNEDVY 485
12084836  390 TDWGEGRLTCFFREPTLIENAAIAKLDFSAFFATLYLGLFPCHTRLRDAVLARLRRESDWLKRPIVEFGGLLKHFREDIY 469
10834877  480 RAIICIGNHISLEVEATASALGFAPCTYVKDGLWGTFTDGANNVLHSSKGTETALETLRVACGKSANKLATSVGLRFPED 559
125745059 486 QSIISIGNHISIEVEATASSLMFAPCTYIKDGMWGTFMDKSKNVPRPPMDDERDFNILRNACAESANNFAATIGLQFPDE 565
12084836  470 KAIVGIGNLISLEIESAASTLMFAPCIYVRDGMWGAFIDKANGTIVSPEGNGNIFETLRVLCNESANRLTTSIGLRFPDG 549
10834877  560 IRLEFRMEGVYTHAVSWNANCYWLWNETKRETDFVGFPARPAFAGQVKKALSALLEEISACNDSDESLRTIQERSRAVFE 639
125745059 566 ILLDLRLEGIYTHAMSWNANCYWLWNKSNHHKDFVGFPNQPRFASYAKHGLSTLLEKICISNDTDESLQTVREKTHEVFE 645
12084836  550 INLQMRLEGVYTHAMSWNVNCYWLWNRNTRESNFVGFPKQPEFATHAKEAMSTVLEEICLCADTEDALLTIQEKVQKMYH 629
10834877  640 ELVTAAFEARGDACFWSCPAESRDHTHYITALGLRAAARFDTSAFSNDAVHTVTVDGSIAPLTCSLFEGgQVILPAIACI 719
125745059 646 ELLSIAFDHRSDVSFWSCPTELYDDTQYIAALGMKAAARFDTSGFNRETVQTVTADGKIVSVTCSLFEG-EIILPAIDCI 724
12084836  630 DLLYMAFKKRGDASFWCCATDSYNDSLYAVALGSKAASRCDTSAFRREMVQAVTTNGNVVPVVCSLFGDtHFIVPAISCV 709
10834877  720 DHMKPIMSIFSRLLIGALTSKWPNVDLSKFTFDVEPYRFLFVRNK 764
125745059 725 DYMKPILAAFSRLLINVLSSKWDNVNRDDFTFDIESYRFMFINNK 769
12084836  710 DHMKPVLSALSRLLGSVIAFKWPSVDQGSLMFDVDHYRFMFIRNK 754
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap