Conserved Protein Domain Family
PHA03180

?
PHA03180: PHA03180 
helicase-primase primase subunit; Provisional
Statistics
?
PSSM-Id: 165451
View PSSM: PHA03180
Aligned: 4 rows
Threshold Bit Score: 1867.59
Threshold Setting Gi: 255683140
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
10834924     1 MSDIPEDADP-----------GIKVLFAVDGCAVSFSLALLTGQVPSINPVYVISHWDPGNRLLDVLCHRADDRDCGRIP 69  
12084881     9 VDVSSESVSS-----------SIKVLFAVDGCAVSFTLGLLTGQISSTNMVYIIAYWDPDDVLSQNTFLAEVENNSEPRS 77  
125745105    7 ISDTLESDDS-----------GIKVLFAVDGCAVSFSLALLTGQIPSTNSVYVIGYWDPSDRFSSIPFLDGDPNTNERIS 75  
255683140    9 NLDFSDNEDDmdfvkasiendPIRVVYATDGCVITHSLMLMAGQV-NLGDIYIVSYYESGRSI-----LEHGSNGANETC 82  
10834924    70 NERGDLNAVSDPLKVEFCLLSQMTRGLGGADLKLRTRAIFVCRFTSHSEINSIVASIASGAPIQTDLLIATLSEYDTFRL 149 
12084881    78 TGSLTLQANTESLRIEFCLLNQMTSCMGGADMKLRTRPIFICRFKSKSEIGAILSSITHGLPIQADLLASTVCEEDTFML 157 
125745105   76 TTVCNLEDVPSPLRVEFCLLNQMASGMGGADLKLRTRAIFVCRFTSWSEMNAIANSIIYGTPIQAGVLQATISETETFML 155 
255683140   83 QDFAAPPEGISSILVDFCL--PCPNRVCGNARKDRVRPMFVCRFTTERGLCSIYAALMHGKPLSSEIVAEALIEDATYAL 160 
10834924   150 HDDFNIALHISLACLSQKRRNGKEPAKSPDRNLLSIMAGTFSGGRRGLAGLYLQYEQKVTAAYRRVYGGSTTTAFWYVSK 229 
12084881   158 HDDFNLALHISLSNLARSGRNHKHANKIMSKDTVLSLSQSFRGGKRGLTALYLQHEQKVTAAYRRIYGGSTTTAFWYVSK 237 
125745105  156 HDEFNLALHVFLNGLSLKGRNKKDVCMSLNHNYISSVSENFPRGKRGLTGLYLQHEQKVTAAYRRIYGGSTTTAFWYVSK 235 
255683140  161 HHALNVTLYVAFGGATSRRGRSADSAEPLTTNSVKALTSTYPGGQRGFAALYIQHEQRVLAAYRRAFGG-VVTPFWYVSK 239 
10834924   230 FGPEEKSLVLALRYYLLQAQAEPTGIATGYDLQAIKDICDTYAVPVEANPTGFSTADLTSFARLSRFCCVSNYANGPVAR 309 
12084881   238 FGPDEKSLVLALRYYLLQAQDDISGAATDYDLQAIKDVCRTYDIPTKPNPTHFSTADLTSFARLSRFCCSSDYARGAIAR 317 
125745105  236 FGPDEKSLVLALRYYLLQAQEEVTGIATGYDLQAIKDICKTYAVSVNPNPTGFLAADLTSFSRLSRFCCLSYYSKGSVAI 315 
255683140  240 FGPDEKTLVLGTRYYLLQAH-ECGERGSDYDLQAIRDLCGTYNVNVGTNPTGLVPSDLTSFALLSKFCCSSNYARGRIAS 318 
10834924   310 AFPLYVEHRIAADVTEVDALKEYIERDRSGLKISDLEFVKYIYLAYFECYNRAQLRRHLRDVTVRCPEE---DVYKRSSL 386 
12084881   318 AFPTYVEHRIIADVSEVDALREYIERDRPSLKISDLEFVRYIYLAYFECYNRKQLKRHLEDVTVKSPYE---SIYQKSSL 394 
125745105  316 AFPSYVERRIMADIAEVDALREYIERDRPSLKISDLEFVKYIYLAYFECYNREQLKRHLKDVTVSLPDE---DIYKKSSL 392 
255683140  319 MLATYIERRIAADMAEVGALREFLVNDRGCLRISDKDFVTYVYLAHFECFNREQLTNHLNAVTVREPEEtemNIIGKSGM 398 
10834924   387 GKHAVDNFFTHVRSRLNVNDHIACNVSPDQVEMGNVLTRAFCRARTYPPSTM--ESDARFTGICEPSSVIIKRLDALEST 464 
12084881   395 GRRAVENFFTHVRSRLSVHDHITKNVSPEQVELGEELGMAFIDARTYSPCTM--TMNSCFMGLCECATLITKRLDRLETK 472 
125745105  393 GKCAVENFFTHVRSRLNVNDHIAHNVLPEQVEMGNKLVRKFGRARMYLSTTM--TNESHFTGICECASVILKRLDTLEMK 470 
255683140  399 GERAVESFFSHVRAQLNIDDYIKQNVVPKVLVLTPDLAKMYVNSKTYHKDTFkqTHGNTVVGIWDYATQIARRLDKVEAA 478 
10834924   465 LHKYGWPRARSETVNM--MSECANLPiASSADSLRPPGLPLEHPGTHCR--------GGPMIVKRLLALVSADARVGDIG 534 
12084881   473 LQKHGWPCSRFDGTNV--LSDNSNVP-HSSFDDRTGICDSFQEPALATR--------GGPMIVKRLLAMVSSDGWSGNVG 541 
125745105  471 LQKYGWPSDRVDGSNL--MADNQNNStLIPYDKSRSSGMILECSNTHSR--------GGPMIVKRLLALVSADSRAGGIG 540 
255683140  479 LVRRGWPESNPSAPSLhqTGNRQNDPsDNSYNRDNCDELQYEQGDWMPSqfqigiqgSGYGIVKRLLTIAATEPPAGTMA 558 
10834924   535 PTNMLTGIrESAVKGPLPIYRIGMSKGKQAFAVMVADCWDKIIPSPGIVKAHL-SKLGRSgRAPEDDVIARDIFFTSELE 613 
12084881   542 PISMLMGL-NVSESGPLPVYRVSMAKGKQAFVTLAAECWERVIPPIGTIRDRL-SRLNIA-GMPTDDLLSRDRFMNVEME 618 
125745105  541 PANMLMGI-DSAIDGPLPVYRVGMSKGRQAFTVLMTECWERTIPSPGSAKAHL-IKLNNSyGTSTEDLISRDLFLTSEIE 618 
255683140  559 PACLFIG--SKTSNIPLPSYRIGMPNGKQAFGIITGDVWSRITGKNDTFEPVIqTSLGMReQLSLSDLAAVDMKITSIVT 636 
10834924   614 RVTGHA-AELPYFTCGPAEEQQYINRNEVFNDNLIVGNIILDVDVHLRTPVPVKLLHVAMRGFRTGALKALSLLLPKAKI 692 
12084881   619 RILGLVgTEMPYIACGPAEEQRYINRNEVFNENLVVCNIVLDVDVHLKQAIPSSRLHAALRGFRSGTLRALSLLLPKANL 698 
125745105  619 QLIGST-VELPEITCGSADEQQYINRNEVFNGNLAIGNIVLDVDIHLRNPIPLRLMHAAIRGFRSGILRALALLLPKANI 697 
255683140  637 SSFEN--QRSIFIASSIVGEQMYANRNEIFNGSLAIGNIILDVDMHLKQAVPLIALHTAMRGFRKGALTALSLIMPKTDV 714 
10834924   693 DHGSYPCYFYKTSCKKSRVVHVKHWMSSTTDFALDCD-------------------GPAVESADCELEMGFDDPLLMDQI 753 
12084881   699 DLRSYPCYFYKSSCKKSQSVRFARWTHLTSEYTYDYE-------------------GSCTQTWDFDTDISIDDPLLIDQM 759 
125745105  698 DHGSYPCYFYKSSCKKSRVMGGAPWMLHDAELAPDY---------------------SMFENAEFDLEMGIDDPLLIDQI 756 
255683140  715 DWSSYPCYFYKSACTNDGRVKTSKNVDNQHSSGLETDehyemledpslyhdashilDEPFDSYDSGFEGYNDETALFEML 794 
10834924   754 DDSISR-CESDASSLPSDADL-----------PCNCHEKIGLRVCIPVPPPYLLVGSRTMSGLARVLQQSVLLERSFVEP 821 
12084881   760 DESASRwTSDSALSAASDADI-----------PCGCQDKIGMRVCIPVPPPYLLIGSATLGGISRIIQQAVLMERDFVET 828 
125745105  757 DESLTRwSSESSRSVDLDPDK-----------PCGCHDKIGLRVCIPVPSPYLLVGSKTLAGLSRIIQQAVLLERNFVET 825 
255683140  795 DSAPNEeCSEQEEEIDIKSELtnrldtvasnvTCDCVKKIGMRISIPVPTPYLLFGSKTMVGIARLIQQAVLLDRSFAEA 874 
10834924   822 IGSYLKNYDIVDSGVYGHGRSLRLPFFGKIDETGLISGRLLPFCVIPERCGDAEQFVLSHLQPKTFHFHSPMPEEDHASV 901 
12084881   829 IGPYLKNYDIIDVGVYGHGRSLRLPFFSKIGDDGLVSGRLMPIYVLPDICENPDTFVLSHFDPRTFHFHSPRMTRLPVST 908 
125745105  826 IGPYLKNYEIIDSGVYGHGRSLRLPFFGKIDENGIVSRRLVPFFVIPDDCADMEKFIVAHFEPKNFHFHSSIPLE-KAAI 904 
255683140  875 ISIYVKDYNFIDTGIYGNGRSLRLPFLGKVTTENNIVGRLLPFIVVPESCNDVNSFISGHFEPRNFHFHSLPIVNEMPHH 954 
10834924   902 VLKGLGGEYAGFFEKKITINRDTFFGIRLSLAVALKARGVDINDSAAIVSFVTEHILDDIIQYMHDHIPDHAAEYNHVSV 981 
12084881   909 VIKNLGGEYAIFFEKKLTVNRDAFFGVKRSLSATLRERGIDVNSEDSIIAFVTDFILEDISRYMNEHMPECAVEYRNMGI 988 
125745105  905 ILKDIGGEYAGFFERKITVNRDIFFGTRLSLSIALRERGVDINDCAAITTFVTDHILDDIITYVYEHIPDHAIEYQNLSV 984 
255683140  955 VIYSLGGDYISFFDAKTNHNRDRFFAPRTSLVEALGVLGVCATDSTAVEEFATCFILEELIRYLENHFVGYAHEYKNAIA 1034
10834924   982 SCCVIRPDWILLQLMANKTLGRAHGFTCVRFKHTRTTRMSSRSYLSLNIDAHGRLCACVIQQCFAAKCGNNKLRTLFTVD 1061
12084881   989 SGCVVRTDRILIHLIPNTTASRGRGFTCMRYKHTRSSRTSARSYLALNVDAHGRLCVCVIQQCFATKCGNNKLRTLFTVD 1068
125745105  985 SCCVVKSDWILLQLIPNKTIGYRHGFTCVRFKHARARRASARSYLALNVDAHGRLCVCVIQQCFAAKCGNNKLRTLFTVD 1064
255683140 1035 RCRILKADWLLLQLIPSRS-SHLNGFSCVRYKHTRTTKGSARTFLAISVDAHGRLCASLSQQCFATKCGSNKLNTLFTVD 1113
10834924  1062 VDSKCQAEHR 1071
12084881  1069 VDSKCRTDQQ 1078
125745105 1065 IDSKCRLEHQ 1074
255683140 1114 IGGAINSKTR 1123
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap