Conserved Protein Domain Family
PHA03178

?
PHA03178: PHA03178 
UL43 envelope protein; Provisional
Statistics
?
PSSM-Id: 177552
View PSSM: PHA03178
Aligned: 6 rows
Threshold Bit Score: 290.618
Threshold Setting Gi: 296316017
Created: 9-Dec-2010
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
9629741     1 MIYRPGRELGEDSCVVLSSFSVQRCTGSQKGCMPCTWAASKAFIGIGLQACVLTSSIIHVDLLT--KNSTCLIMMLISLY 78 
50313258    1 MMYQPDREPGEDSCLVLSSSSVQRCTGSQRGCMPCTWAASKAFVGIGLQACVLTSSILHIDLLT--RNSTCLILMIISMY 78 
216905870   1 MMYQPDSEPGEDSCLVLSSSSVQRCTGSQRGCMPCTWAASKAFVGIGLQACVLTSSILHIDLLT--RNSTCLILMIISMY 78 
270339456  17 TTNNNGLAPEGISDITLPSFTVRNCSGSRTGCIACVYTATKALCYIGVQSGILTASIALIWLLT--RTTTYAAGILIFIS 94 
9629831     1 ---------------MFASVRVSGCAGARAGCGPCALAATGALVAMGTHTGLMAAALATVGRAQ--DPAAALALTATAAA 63 
296316017   1 ---------------MFASRRVSGCAGTKAGCGPCALAATGALAAMGAHTGLTAAALDAVGRTRgpAATPALAAAAAAAA 65 
9629741    79 VLSLIRVHISRM-ETLVTVCRFVQAISTLIAAGVWVAGHIIKKEQLLIVVTVCILFVFISGAQISLFYVICAANGTGTHF 157
50313258   79 VLSLIRVPISKM-ETIVTVCRSIQALATLVAASVWVAGSAVKKEHLLIVVTVCILFVFIAGTQISLFYVICSANGTGTHF 157
216905870  79 VLSLIRVPISRM-ETIVTVCRLVQALATLVAAGVWVAGSAVKKEHLLMVVTVCILFVFISGTQISLFYVICAANGTGTHL 157
270339456  95 LISTMRLSMVKT-ERITTICRFTQTLCVAIAAVGWACDDLLQPVGFTPLLLLCLAGIAVCAAIIHVFYFICTANGSGTHF 173
9629831    64 ALVCWRPAAQTLrRRLAPLGRLAQALAVAAALAVWATDPA--PAVLRGVTTGAAAAYVVCGVPVHCAHFVTAASGTGAHF 141
296316017  66 ALVCWRPAAQTLrRRLAPLGRLAQTLAVAAGLAVWAAGPA--PAALRGALTAAAAAYAVCGVPVHCAHFVTAAAGTGAHF 143
9629741   158 RASLLAIISGCLLGASAKLVEInnKDVPVGLGIAIAIITSCANFGLNLRDTCHYRIGRYACMRTFTDLGRGVNYTWITNA 237
50313258  158 RASLLAIIGGCVLGVSVKLVEL--KDVPIGIGIAIAIIASCQDFGLALRDTCHYRIGRYACMRTFTDLGRGINYRWVTDV 235
216905870 158 RASLLAIIGGCVLGVSVKLFEL--KDVPIGMGIAIAIIASCQNFGLALRDTCHYRIGRYACMRTFTDLGRGINYRWVTDV 235
270339456 174 RMAIVTMTLGALLGVSSIAVTVk-SEILIGLGIACSIIVSQRDFGMILRDTCHYRLGRYSLMRTFTDLGRGANHNPVDFI 252
9629831   142 RTALLTMTCGLLLGLSAGRWGAr-PEALAAAGAAAALVVAATDAAAALEDTCHYKIWRYAALRTLAPLG---------EA 211
296316017 144 RTALLAMTCGLLLGLSAGRWGAr-PEALAAAGAAAALAVAAADAAAALEDTCHYKICRYAALRTLAPLG---------EA 213
9629741   238 GAEPKIEEVAEEKVSLFKFFKELPGVIFSPAVGTHATPIIWIVLR-LGYGLSNVWQTPAYVVFCLTVGHVSAMFLEQ-LI 315
50313258  236 EAVPKIEEVAEEKVSLFKFFKEMPGVIFSPAVGTHATPIIWIVLR-LVYGISNVWQTPAYVVFCLTVGHVSAMLLEQ-LV 313
216905870 236 EAVPKIEEVAEERVSLFKFFKEMPGVIFSPAVGTHATPIIWIVLR-LVYGISNVWQTPAYVVFCLTVGHVSAMLLEQ-LV 313
270339456 253 --VPNIEDVYEDKISSVKIFREHPTLIMAPLIGLTLTPPIWGYCHiTKYGHD--FQTPLTVVICVIVGHCLAFCLEPlMV 328
9629831   212 ACPADPCGAREDAVPMRALARAAAAELALSAAALAAAAALWAPGRaLGLEGGGRWRTRGAVLLSVAGGHGVALAEHLcLR 291
296316017 214 PCPADPCGAREDAVPARAAARAAAAELALSAVALAAAAALWAPGRaLGAEGGGRWRTRGVVLLSVAGGHGVALAEHLcLR 293
9629741   316 VRINYTAEASSGIHATAHAVCVVLAAFGYWVAAPISLAFTTSGGVLGALYLRKRATGASRLAATHISRWLIVSVYVAAGL 395
50313258  314 IRVNYTAEASSGIHSTAHAVCMVLAAFGYGVAAPLSLAFTVSGGILGALYLRKRATGARRLAATHISRWLIVCVYVAAGL 393
216905870 314 VRVNYTAEASAGIHSTAHAVCMVLAAFGYGVAAPLSLAFTVSGGILGALYLRKRVTGARRLAATHISRWLIVCVYVAAGL 393
270339456 329 YRRMYIPEVLVSFHGMAEITGIVLALLGVNFGTPLVLTLAISETLTCLLHLRKIILGAKRLAATYLCRGLHTGMYVTAGM 408
9629831   292 YARADAADGALMAHVGICALGAALPLCGADGGAPAALASAAAGTLVACVWVRRCGRGTARLAAAHVAKALHAALCFCVGA 371
296316017 294 YARADAADGALMAHVGVCALGAALPLCGAEGGAPAALASATAGALVACVWVRRRGRGAARLAAAHVAKVLHAALCFCVGA 373
9629741   396 CYATIIT 402
50313258  394 CYATIIT 400
216905870 394 CYATIIT 400
270339456 409 CYLYSHM 415
9629831   372 CWVCADE 378
296316017 374 CWARADE 380
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap