Conserved Protein Domain Family
PHA03175

?
PHA03175: PHA03175 
UL43 envelope protein; Provisional
Statistics
?
PSSM-Id: 177551
View PSSM: PHA03175
Aligned: 2 rows
Threshold Bit Score: 807.272
Threshold Setting Gi: 20026644
Created: 9-Dec-2010
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
52139228  11 VSAGNVPRDSIPCITNVSADtrgrtrpSRPATVPQRRPARIGHFRRRSASLSFLDWpdDSVTEGVRTTSASVAASAARFD 90 
20026644   1 MESSQKPRDRVPCITNMPGG-------GRSGSNVRRRPACIGDIRRRSSSLSQVSF--EAAPGELERRDSGTSTRSGQHH 71 
52139228  91 EIRRRRQSINDEMKERTLEDALAVELVNETFRCSVTSDARKDLQKLVRRVSGTVLRLSWPNGWFFTYCDLLRVGYFGHLN 170
20026644  72 RPLRRRSSGLDVMKERSLEDALAAELVNETFRCSVAPDARKELQKLVRRVSGTVLHIGWPFNWYFTYCDLLRLDYFSHLN 151
52139228 171 IKGLEKTFLCCDKFLLPVGTVSRCEAiGRPPLPVLIGEGGRVYVYSPVVESLYLVSRSGFRGFVQEGLRNYAPLREELGY 250
20026644 152 IKGLEKVFLCCDRFLLPVGTACQGEP-GRAPLAIFIGEGGRVYCYAPSGDCVYLISRSGFHGFVSNGLRNFAPLREELGW 230
52139228 251 VRFETGGDVGREFMLARDLLALWRLCMKREGSIFSWRDGNEALTTVVLNGSQTYEDPAHGNWLKETCSLNVLQVFVVRAV 330
20026644 231 THFDSGGDLGWEFVVARDLMSLWRLCMKHEGSVFSWVDNRESMTTCVLNGGQTYESPHHPTWLKDTGSLNVLQIFTVKAV 310
52139228 331 PVESQQRLDISILVNESGAVFGVHPDTRQAHFLARGLLGFFRVGFLRFCNNYCFARDCFTHPESVAPAYRATGCPRELFC 410
20026644 311 QVEPHRRLDISILVNECGLVFGVHPETNRAHFLARGLQTFFNVGFLRFNNNYCFGRDCFSHPESVLPAFRATSCPRDVFC 390
52139228 411 RRLRKKKGLFARR 423
20026644 391 RRLRKKRGLFGGS 403
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap