Conserved Protein Domain Family
PHA03172

?
PHA03172: PHA03172 
UL37 tegument protein; Provisional
Statistics
?
PSSM-Id: 165443
View PSSM: PHA03172
Aligned: 2 rows
Threshold Bit Score: 1661
Threshold Setting Gi: 57790962
Created: 9-Dec-2010
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
38638227   4 KSACKNALAQLAAELSSASKRdtssgstrnsAPELTSLLADLLLSRDDVPLEDLEATTARSHLAKGVFAACKLVPFPVAE 83  
57790962   1 MQAITDSLKACLEAVHTDCSK----------VPGVTSALTGILISRNRIPLEDLEKVEARKNMVETIMLACTMAPPAVAD 70  
38638227  84 VAVRLAVRAIMRRVVVPWQAGENFSMIQRVREAFLRLVDDFDNASKTELNAPFTQCSEYKDLIGGWLTQFGNAVVLTMSE 163 
57790962  71 VTLKLFARSLISRISVPWNSGEDFRIIQYLREAFTGLQHDLETAVRKEFPGLNDPNVEYWSLISGWLTEFGSLARLVVDE 150 
38638227 164 QQLLDDAGSVLNPPEVLAPLVERYPLLIDHVMVQEGMDYLGGKLQSLVAYHALLRCATRPHENGKVPVLAALTMVAEYFD 243 
57790962 151 RQLFETSGDRLEPTKLLSPLIENYPLLYDHQMVQDGIQYLGTKLQGLVGYHAMLNYITASTGLPKTKALMTLSMVREYFE 230 
38638227 244 PETKPAYRKVPQKAVAAFDLNltdevvsslvyDQAAAPVVQSEQPVLPQSESLLFTEVVRTRNMLALVqpsatwegsgaa 323 
57790962 231 PTVKPPYRKFPQTALAAFDLD-----------TDSAKSWIAKDLDSRYFSISQLYANAAYSRDPLLVL------------ 287 
38638227 324 lrnaaGDAKRRQqqaARGAGMAWRCGVDALFSVPMEHVAMNVPAVMQMLHEPPTDIPAEYERALSLYATDTIDAIAKFPD 403 
57790962 288 -----GDPPKTH---VPGHVVCWRHDLDSLLTIPIKRLALDVPTIVQLFEDAPNNLTEEQKETLTAYTTSTADMMGRSPD 359 
38638227 404 LAASSGTEAVIRSLALRGFTKTNCERYLFAAEAFLEPQAPGTPLHDFYAAVIYASVVGLAAHSLYAYNQHTIFYPEKYSR 483 
57790962 360 LAATGGPEEVIRTLVLRGFTKSNCELYIQKAEALWGEDTDGTIIGDFLGAVVYTSLIGLAAHSMYTYNPRTLQYSGHYAG 439 
38638227 484 VLKKTVEAHAYLLDMMGLAISDALISLRAFAPKPPHQAFRTVRDTLAAVVDSVETGAEEFSDLIVSDYVQRLTADFYGGI 563 
57790962 440 LISDWGDPYSHLLRRVGVSESELLLPLRSFAPAPSKNALNIIRDTLASFIDGSDGGPEALGNLGVFNFVQHLISDLGGKT 519 
38638227 564 HENEQWLSERDaairqrmeiAAAGRRETDSAGRRPGLGFHELAALVQGLQIGGKEPKAVVEYATAPAGAASagATFSALF 643 
57790962 520 QENLDWLERRE---------KAKDKGYASADKQSYTYGFDQTVKLVQAIEVGGAEPEEICSRNGTDPKIDM--QLFSNLS 588 
38638227 644 AAAIVRDVMEGAAAIPFEADALARLNKALSWLRDFGLSwNMPDGSHYRRRVIALQAAIHPFVTGKIGVDAVTVKQARALE 723 
57790962 589 VATVLRDIVYAVSTYPFTVDAVQHAVKLLSGIEIRALR-KPSDTQKYRRAILEFQLAVSPFITKTNPTEKISIESASAIE 667 
38638227 724 TAMGDLYAACEYSFQALPPPYVGGLRKAAAPSRQHSPLLAQAYTNAAMGDLGVLTKTLAKSAEEISKTVRDMVSRLLSAR 803 
57790962 668 KALLKISDACDRSLDTLPETFKKTVQPVPAVDTMRSKFISQAFEQAATRDLEEVSKTLNNASMQISTAVQILLSKTANIR 747 
38638227 804 DLFSRRATASDKNAVTIDAAgPGGTVLGTWEDESVMSGLWKTVNFTEAAIRNTERAVRELEATKRETQDLEESYWQLASg 883 
57790962 748 PLLSQSANADFLGNVSFSSC-RDKKELGHWKDDTVMQAIWKAVNFAETAIRHTEKAIRALDSTKVKTHALETTYWQLAG- 825 
38638227 884 rdgagnAAQPSESLYQQVAAELVEIADARNAVVVRARSLYRAIAGTGLKRIRTFVKAWRLFLKAERSLAKQ 954 
57790962 826 ------YAQTRSHICRKVAEELSGIADARNTVVQRSWTLCRSLAGVGVKRARDVVKAWKTFSDNEAALETS 890 
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap