Conserved Protein Domain Family
PHA03171

?
PHA03171: PHA03171 
UL37 tegument protein; Provisional
Statistics
?
PSSM-Id: 165442
View PSSM: PHA03171
Aligned: 2 rows
Threshold Bit Score: 829.323
Threshold Setting Gi: 20026639
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
52139223   1 MSPVYVNLLGSVGLLAFWYFSYRWIQRKRLEDPLPPWLRKKkacALTRRSRHRLRRQHGVIDGEnsetERSVDLVAALLA 80 
20026639   4 MSLPYVHLVGGVGLLTFWYLSYRWIQRKRAEDPLPPWLRSE---VRRQQRRTRLQRQYGVIEGE----EWPRDLTFALFG 76 
52139223  81 EAGEESVTEDTERE--DTEEEREDEEEENEARTPEVNPMDAEGLSGLAREACEALKKALRRHRflwqRRRRARLLQHNGp 158
20026639  77 RTGQEAEENNNDYScpDYYAGERRREEEIETPDPEVNPLDAEGLTGLAREAYDALKKALLRYR----SRRQARCETHVG- 151
52139223 159 qqshhaaVFCRVHGLRGFQV--SVWLLLTLFWSTGYGVSVRCTYHGTDINVTSNATSMNCRLNCTCNHTQIYNGPCAGAE 236
20026639 152 -------VFYRVAEKRGSQVfiTLLALLSACVLTVHGVTAGCTYSAPVNQTDRNGGFQNCKMNCTYNGTVIYCGPCLGAK 224
52139223 237 SKLPLNVTF-RQSRRQWHSVMLTFGFQYHLEGWFPLRILNESR-DINVTEVYGEVAC---FTNDTNITMGQLTLNLT--G 309
20026639 225 KALQLNMTFpRKGNRHWHARMLNFGLRFHLEGLFPSWVLNQSDlKSNVSQVDGAIFCntsLIDRRNITTGLLTLNLTtlN 304
52139223 310 RSYVLRALARTSPFESSVNWEETNvtdnaTSSENNTVTVMSVLTVYAESDYIFLQDMCPRFLKRSVKLaKNNRRNTTFTG 389
20026639 305 IGYVLRAASNVDVTRRHVYWNVTR-----NDTDNATDVVKTVLSRHVESNYIFLQDVCPRLLRRFQRL-NVSITNVTVNG 378
52139223 390 TNVTSLPEWtlQQCQGWKYWTTLSIMWKNRRSALLRAKSRALGHWALLSICTVAAGSIALLSLFCILLIGLRRDLLEDFR 469
20026639 379 GSNNVTAVW--NDTESWGMWSKLSVMWKNRRVEFLRSQSRALGHWAMISMFSATAGTLVILSLFCMVSFWRRRDLIEDFR 456
52139223 470 YICRDEGSSSTKNDVHWIV 488
20026639 457 YTRQDDDHFFIDSGVDNAV 475
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap