Conserved Protein Domain Family
PHA03170

?
PHA03170: PHA03170 
UL37 tegument protein; Provisional
Statistics
?
PSSM-Id: 165441
View PSSM: PHA03170
Aligned: 3 rows
Threshold Bit Score: 488.277
Threshold Setting Gi: 51874240
Created: 9-Dec-2010
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
9628320    1 MKKLTMESLSVYIFVMGVCFTSNFTCEQKIVLIQEHKLRSICISTCYVNGVLAGNSSCVSVKTSYLINLAMLTNGFKAMR 80 
9633087    1 MKKLTMESLLVYTFVMGVCFTSNLTCEQKIVLIQEQKLGAICISTCYVNGVLAGNSSCVSVRTSYLINLAMLTDGFKAMK 80 
51874240   1 MGKEMM--FFVFLICLSLTLMSNLKCHQNIIFL-DNKLEAVCVTTCYVNEMLIGNSSCLSVRTAFLISLSLKTEGFREMS 77 
9628320   81 VGNITSISEKTAFLRVIINYYFRGVMLRALIAQRLPNAANLSSTVNCWLDDHSAGGVMTLFYGTERIVLNSSTEINASRW 160
9633087   81 VGNITSISEKTAFLRVIINYYFRGVMLRALIAKRLPNAAQLSSTVNCWLEGHSAGGVMTLFYGTERIVLKSSTEMNASQW 160
51874240  78 LVNLTTTSHKLTYLRVLINYYFRGVMLRALIAKKWHFASRANSTLECWLEGHNSGGSITIMTGGQKFLLQLRSGIVAVKW 157
9628320  161 ISDGQDANGTLNILNERVSLDIYFLSKICPQLSSEIYKKKVAHPKYFSLIKNDTKPKKFLRNTWRSAWSNWYKYKEIKEF 240
9633087  161 TSDGPDANGTLNILNERVSLDSYFLSMICPQLSDEIYKKKVVHSKYFSLIKNDTMPKKFLRNTWKSAWTNWYKYKEIEAL 240
51874240 158 RSVGKDKNKTLEILNQKFNYDCYFVAMICPHLSDEIYQRKVLNPN-FTIVRNETIYKRFLRKTWKSSWLDWYKYKELEDL 236
9628320  241 --------LDFSSDYENFSEITYSMSAAGLFFLAGGAFTMLLLLCCLSMITRKHIVKDLGY 293
9633087  241 --------LDFSRDYENVSEITHSMSAAGLFFLAGGAFTMLLLLCCLSMITRKHVVKDLGY 293
51874240 237 sasyggknVIFLNDYESFLDQTQA-TTIGVVFLVGGSAMVLFLFFCLSIVNRRKVDKNVG- 295
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap