Conserved Protein Domain Family
PHA03166

?
PHA03166: PHA03166 
hypothetical protein; Provisional
Statistics
?
PSSM-Id: 177548
View PSSM: PHA03166
Aligned: 7 rows
Threshold Bit Score: 624.147
Threshold Setting Gi: 14251008
Created: 9-Dec-2010
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
9845318     2 DSWSKRNGKAPREITRFLSVDEPFDH--------VELKISYLKNARFATANGHYGIIGLALRWDTAVWGLLREIECVPYS 73 
61660149   70 MDAWSRESGKATEIRSFIRLNKPFNH--------IELKYSYLKNARLATANGGYGIRGLTLAWDSAIWGLLREIEFVPFA 141
52139213   69 avragllCRTPEDLAAAGGQKRKTPApkhpkhamVYIRRSCLVHSACATAHGKYDIRGLTLESDLAVWAALRGVPLPPDP 148
51556506   56 DSSSSSLTKKPRDTRVVQNAESAKKSp------iIYIRRSFLVNSKFATAHGKYNIRGLSLQTDLAVWGLLRGVPLRPDP 129
14251008   47 SLAELRLRRKRSAARDDGPGCSSARDvvyrpivvIQFRSSYLQNAEFATAAGKYRIRGLLLPWDTAVWGLLRRSALPSRF 126
20026630   71 avrhgllCRTPEDLATRHQKPRPAGSgkrskhamVYVRRSCLAHSAEVTAHGKYDIRGLTLEWDLAVWAALRAIPTMPDP 150
213159174  57 DSESDADDDEDEPLFTELQPSVSERSvfmnpckvIQIAHRYFTNSCSCTVAGKYGVKGMTLPSDLMVWSRLMAPVLTSAT 136
9845318    74 NPFVFPNCARLSGIIAAMQFRPEANEVVRALCRACVAAQYGVSILFSYDHCAAVPRYLRSLVQELVELNDRIRHLSIVSN 153
61660149  142 NPFSFPSCDGIAKILFDLEWRPEASDSCKALGRATVAIQYAISLLYGYDRSASMSRYLRRLVNELIDLHDRMRNMSLMSS 221
52139213  149 QHFRWLNAGAFRRLVHEAQYLPEISRAAKRIALAVATGQYVVCTLLDYKTFGTRTHYLRQLCSMTEELYLRLDG---TLC 225
51556506  130 GHFHWMNLMQFRRLVAAGPFLPEISKSGKRIALAVATGQYAVSTLLNYKVFGNKTHYLRQLCVITEELFRRLAG---TVC 206
14251008  127 NPLQRLRAADLCSYLNTVAFRPEASDVARHVARTVAVGQYAVQTVFDYRNPGGLSHYLRFLCESVHALYGRLER----IG 202
20026630  151 QHFRWNNAGAFRRLVHRARYLPEISRAAKRMALAVATGQYVVCSLLDYKSFGTRTNYLRQLCTLTEELYMRLDG---TMC 227
213159174 137 NPVLESQHREFARLLDRVEFRPEATDVVKVMCKALATAAFCMEHHFKYPYPGSLSGYVRFLNYVACLTYREVEDAWSSLS 216
9845318   154 LRVEAEDLGVIQGVLPERVAALLGVPAAHE---LflsDEYYDCVEAAVDAMFDRFCECAECGMRRSERIVAVRARALGDA 230
61660149  222 LRIPGHDLEIVQRLLPERICQQLGIPFSFEsclL---DSYYEYVEMTMEVIYDQLCYCRECRMRRGERLERLRAQKIGTK 298
52139213  226 LFLEPEERELIGRCLPAALCRGLPVKYRTHraaVffhATFMARAEAALKDLYAAFCECGDGRD---DGGNHNGNYGGGDH 302
51556506  207 LFLDAGDRDLIQKCLPPHLCKKLPVNYRVQknaVffnPRFALRAEAALHTLYARFCTCGDCHDLFVASSDTQATPSEEEP 286
14251008  203 DTLDDRARLLIADLLPRAVCRQLGYAYDPDdqtFifdPQYLHASEQVLQILYDRLCDCEECQERRFTAAAAATSLRRGPK 282
20026630  228 LFLDPEEREVIARCLPQFLCRGLAVRYRSHraaVffnATFGARAETALKRLYSAFCECGDWRDPDVPVEAAEAVAAASQH 307
213159174 217 -----NGDAYACRSLMNCLNSRKKKGRSGHlqkAvmdKEYVSRVNVMFERAQIALCGCDECTSGSRHMTTRAVGRQN--- 288
9845318   231 RGLTARRGMLrkkrrnrfFEENDVALPFCPELGRLRLPRIRHLDLVQQELLCRHIGRDLm--FDSMFGVCRGMSRMRGVP 308
61660149  299 YRRRNPDGIRl-------FEENYVRVAAYPNIGVLRLPKIRHLSDEHQTLVCGHLARDLm--YDVHFGSSSPLARVNGIP 369
52139213  303 SSLSPSAVAShh----srLEHAELRLERNRHLGAFHLPAIRHLTAGDVARVQDSVSRDL------GFADWSQTLVDDYFL 372
51556506  287 SPPQPR------------LEDAELTLLHNAHLGKFHLPAIRHLTAAEQLRVQQSVARDL------GFTDWSHTLVDDYFL 348
14251008  283 RRKRSSWAA---------FERRDVVLEQYRELGVLRLPCLRHLKRDQQLELCQQLRHDL------CFRR-RQTLTARELL 346
20026630  308 AHMLPPPHFH--------LENAELRLENNRHLGAFHLPAIRHLTVDDISRIRASVSRDL------GFAEWSQTLVDDYFL 373
213159174 289 ------------------VVEPHLFVLNYPEMGPVNVPTIKHMSVDEQIAYCEGVRGDClcsYAKKIKVWKDVLDPDTLP 350
9845318   309 IPFCSAEKLNlDLAYVLYLASNSYFLCFLIRTVRDVMRHEERAYGELCLGLARDAARALREDVEARVAAGavpprrtyfd 388
61660149  370 LPFTAVDCMDiDLGYALYMANNVYFMLFLIRCVRDVVRSEQREYVDLVTGLVREASVMLRRDVDARIRAGadrpvfvasd 449
52139213  373 LPAGWACANP-RRGYAMYLASNAVLALRIIRLLRASIRHEYTACIRMLSGDVQRLIRLFKGEAALLRKG----------- 440
51556506  349 LPVGLSCGTP-CEGYAMYLMSNAVLALKVIRLLYITIRHEHSACVRALCKDVAFLIRMFRYEASIIRKG----------- 416
14251008  347 LPIGVPCGHGvSDAYALYLASNLVFTLFLAQTLHAIVRIEARAYIDLLSGHADALVGALRRQASYLQHGGlgdgdgndag 426
20026630  374 LPTGWACANP-RRGYVMYLASNAVLALRIIRLLHASIRHEQTACVRMLSGDVQRLIRLFKGEAAMLRKG----------- 441
213159174 351 VKPGLYHLLS-ERARFLTMVANFIVLCQMTQLAAAVLKCEICRCVAAVKELTQEVSEIVTRQFDLFAGGG---------- 419
9845318   389 flDPGLSAEEKDLS----IVGALERVTFRGCrvverrdp--------dgtsvdeRVGCFRQDAAVVLGAAAAYHVPRALR 456
61660149  450 prQDGISDEERDLS----IANALDRLTFSDErpdgyedddnealermfleqryeRMGGFSRDAAKFMDLLDAFRVPKALR 525
52139213  441 --LAQNPVQRRELSrfrkHVHDLKRIRF--------------------------TEDTFVETFCDFLELVQRIPDYRSVS 492
51556506  417 --LAQNATQRMELSrfrrHIHDLKHIHF--------------------------TVSNFLETFCDFIKIVNKIPDYQCIS 468
14251008  427 psGGRSPSDGRKLArltrRLRGLD-FGFGGGs---------------------gSGTAFFTAFCDFLEIVEKLPDYARLS 484
20026630  442 --LAQNPVQRRELSrfrkHVHDLKRVRF--------------------------TVDGFVESFCDFLDVIHRIPDYRCIS 493
213159174 420 --LVESKAARSQHKalrrLSSRLRGLNFGGG-----------------------SGLIFLPAMGELLKLSTMVSEYSEIN 474
9845318   457 EHRAREELLAHTLGIRRLYDERV-----------------------------------LAEFHGEKLVPYHLCVGGHWRR 501
61660149  526 ENRAREELLLHTFFIKRMYDERP-----------------------------------LAGFYGDRLIPYYMFVGGYRRR 570
52139213  493 LRIKRELLCLHVFKLRRGCRAPPt----------------------------------PEAVRVQRLLWHSLRHGDA-PQ 537
51556506  469 LTIKRELVLLHLLRLRRVYECPS-----------------------------------AETRKGEKLAWYYFRHGDV-TL 512
14251008  485 EFQVREELLVHHFYLAQVYADPS-----------------------------------PETQAGERLVSYYVQNGDACCQ 529
20026630  494 LRIKRELLCLHTFKLRRVYRPPPssllagshhnnsvvlppptttnasspapssphpdpQLLLRAERLAWHYLRHGDV-PQ 572
213159174 475 EIQTREELLLHVMFLRRMYDDTS-----------------------------------EDMYRAERLVQFALRHGCGSPY 519
9845318   502 DGWAVQARNVTLLDEEIVG--VRGDDMFAGHVDFYERFEEVE---VIREIPVKKRTFMME---LQRMYVSKselaayada 573
61660149  571 DGAVIRMGAVTLSDTEIVKghWRADDLVGMRLRYYDTFEYVD---MLRNISVNKQTLMME---LDRLYVPK--------- 635
52139213  538 DRTRLPQFSSALSDAELSN--------HANRCRRKAPLELGPavvAAPGPSVRYRAHIQK---FERLHVRR--------- 597
51556506  513 DPGLLMTFDSLLADCELSN--------NANRCRRKAPFEIP----TSATVTVRYQGHIEK---LHRLYVRR--------- 568
14251008  530 DAARLRALVVDLSDRELSR----------------APRAEPSwawTIEPTEIVFPPRIREvthFEDLYVRR--------- 584
20026630  573 DRSRLPQFSSALSDAELSN--------NANRCRRKAPVEFAG---FAGGPSVRYRAHIQR---FDRLYVRR--------- 629
213159174 520 TPQDVSRTVTVVGENELCNleDPQTTWPEVKIREF-------------RIGPTCQSYVWT---FANMFKRRnavtdm--- 580
9845318   574 dveieeaadeddgrevefgpagrdrreegirledyddsdlgldadhdpmfgivdgdddddDGDDDDGGDDAMSGDEEDDE 653
61660149  636 ------------------------------------------------------------RELVELVISDKDSSGSDEET 655
52139213      --------------------------------------------------------------------------------    
51556506      --------------------------------------------------------------------------------    
14251008      --------------------------------------------------------------------------------    
20026630      --------------------------------------------------------------------------------    
213159174 581 -------------------------------------------------------cvwayDALPPDYTSCGSEGGAAKGR 605
9845318   654 DADEGPRYVVERLEGYRT 671
61660149  656 EDADSGHSEPSDDGGESD 673
52139213  598 -------FRPHEVGGHAT 608
51556506  569 -------FRPHEVGGCAI 579
14251008  585 -------YWSGEVGGWMP 595
20026630  630 -------FRPHEVGGHAT 640
213159174 606 SGSDGERARERRLAGAPV 623
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap