Conserved Protein Domain Family
PHA03165

?
PHA03165: PHA03165 
hypothetical protein; Provisional
Statistics
?
PSSM-Id: 165436
View PSSM: PHA03165
Aligned: 2 rows
Threshold Bit Score: 88.5812
Threshold Setting Gi: 224020415
Created: 9-Dec-2010
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
9633095    1 MLLISKTLFPIPRSAEELWEGTYTLVVAFVLAFLVYSDYLSNLSPFGEILSSPCIST 57 
224020415  1 MLLISKTLFPIPRGADEFWEGTYILVVAFVLAFLVYSDFLSNLSPFGEILSSPCIST 57 
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap