Conserved Protein Domain Family
PHA03164

?
PHA03164: PHA03164 
hypothetical protein; Provisional
Statistics
?
PSSM-Id: 177547
View PSSM: PHA03164
Aligned: 3 rows
Threshold Bit Score: 96.5845
Threshold Setting Gi: 51874245
Created: 9-Dec-2010
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
9633094   1 MDRPRTPPPSYSEVLMMDVMYGQVSPHASNDTSFVECLPPPQsSRSAWNLWNKRRKTFAFLVLTGLAIAMILFIAFVIYV 80 
9628326   1 MDPPRTPPPSYSEVLMMDVMCGQVSPHVINDTSFVECIPPPQ-SRPAWNLWNNRRKTFSFLVLTGLAIAMILFIVFVLYV 79 
51874245  1 -MTHETPPPSYNDVMLQMFHDHSVFLHQEN-------LSPRTiNSTSSSEIKNVRRRGTFIILACLIISVILCLILILHI 72 
9633094  81 FNVNRRKK 88 
9628326  80 FHVNRQRR 87 
51874245 73 FNVRYGGT 80 
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap