Conserved Protein Domain Family
PHA03162

?
PHA03162: PHA03162 
hypothetical protein; Provisional
Statistics
?
PSSM-Id: 165433
View PSSM: PHA03162
Aligned: 2 rows
Threshold Bit Score: 184.61
Threshold Setting Gi: 9628055
Created: 9-Dec-2010
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
9628055    5 GGGGSKRCPKKQPTPEELAEELVKLRMENKALKSKLKEHVGDD----DVVLTQAAKEAMVGSVVSGLTRSAAKQIEERIR 80 
13095629   1 MASGSRKNPKAQPTMEDLEAKIAQLQLENKQLKKRIKHGTDPQplpgDPIVTPAQREAMIGAATAALTSQASKKIEAKVR 80 
9628055   81 KETLKATTKNEFEEVIKTLSFRVSLSYADLggrassdSSKASKPRGRSKHRAEKQ 135
13095629  81 HHTSRAVTKEELEAAIANIRIRVDLSMEDV-------TLQASKPKVRGRSASKPR 128
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap