Conserved Protein Domain Family
PHA03161

?
PHA03161: PHA03161 
hypothetical protein; Provisional
Statistics
?
PSSM-Id: 165432
View PSSM: PHA03161
Aligned: 2 rows
Threshold Bit Score: 252.724
Threshold Setting Gi: 9631227
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
9631227   1 MNSNRKKFLCSAFEAEINKKTSVSLFDRFGESNCLFLHQLDTTKKSLIKHENLKKQKSIEGMLQEVNLSIQEKKKELSLL 80 
9625991   1 MNSNKKEFLYSAFETEINKKASVSLFDRFGGKSCIFLHQLDHTKKSLIKHENLKRQKSIEGMLQAVDTSIQEKRKELSLL 80 
9631227  81 KTFDRHKLSDTEDLQDKISELTEDLQFEIEALNHGQSSSQEEESSSENTVTGTIMRWRIEALPRVPSTTL 150
9625991  81 KAFNRHKLTAAEDLQDKILELKEDIHFEIESLNNGQPSSQEEENSSETSIPDTIMQWRIEALPRVPSATF 150
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap