Conserved Protein Domain Family
PHA03160

?
PHA03160: PHA03160 
hypothetical protein; Provisional
Statistics
?
PSSM-Id: 165431
View PSSM: PHA03160
Aligned: 2 rows
Threshold Bit Score: 988.818
Threshold Setting Gi: 9625974
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
9631207   1 MPIVYVAGFVDVVAYPKVDPVLYLNLEEVSKCLPLAKPIPLNIEHLPESTIGHTIGLYSVTHGVFCVGVINSEKFLNFAE 80 
9625974   1 MSIVYVAGFVDVVAYPKVDPVLYLNLDDVSKCLPLTKPIPLNIEHLPESTIGHTIGLYAVTHGVFCVGVIHSEKFLHLTE 80 
9631207  81 NLFSNSCVAKTTNKLLPHQPLLEILHTWLPALSLSSLCPNTQNENNDNMFQHVSLCALGRRRGTVAVYSMNLKDAISQFY 160
9625974  81 NLFSNSCVAQATSKFLPYQPLLEMLHTWLPALSLSSLCPTAQNAANTNMFQHVSLCALGRRRGTVAVYSMNLEDAISQFC 160
9631207 161 SISQEEVESIYQDSKNIDLNSLSKPVFNMNPYTLMAKAIDAGFIKDRLQLLRTDKGVAQIKKLTYLKASETPKLGIEDSS 240
9625974 161 SISQAEVENIYQDSKNVDINSLPKPVFNIDPHILMAKAIDAGFIKDRLQLLKTDKGVAKIKKLTYLKASEIGKPVTEDIS 240
9631207 241 EDMNQHGITSQGSDDLISVPKSTFLSMLQNNLDNFKQVTRPVFYPPYLPSQGTYVPYELYNHPPYLGENTGYMLSNGSYV 320
9625974 241 EDMNQHGIVPQGSDDLISVPKSTFLSMLQNNLDNFKQHPRPACFPQYFSPQGAYMPYELYPPQPYSGDNIGYMLPSGSYV 320
9631207 321 PAIFPSRPNKRKREDFEDCVFPGESSLYKDVLNLTKNMSQLQDDLKDLKQAASSQPTRIIPQQFSSSYSFDQGHVPFFRY 400
9625974 321 PAMFPSRPNKRKREDFDDCVFPGESSLYKDVLNLTKNISQLQDDLKDLKQAAINQPNRYPPHHFSNPYSLDPGHASYFRY 400
9631207 401 GPYGIQKNDHPPPPPVCVsqqlpmqplhVQQPPMQAPHVQQPPmqpphvqqprvlpsTDVPSNEAQKPSASESVHVEASF 480
9625974 401 APYGAPKPDQHLLQPLAC----------VQQAPVVQPNYAPPP--------------TEGASNEAPKPSVQEPVHIDASF 456
9631207 481 VQDPVSQIQKLFCDELLNK 499
9625974 457 AQDPVSKLQKMFCDELLNK 475
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap