Conserved Protein Domain Family
PHA03159

?
PHA03159: PHA03159 
hypothetical protein; Provisional
Statistics
?
PSSM-Id: 165430
View PSSM: PHA03159
Aligned: 2 rows
Threshold Bit Score: 307.316
Threshold Setting Gi: 9631206
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
9631206  15 MSSITFQKTIESILNECQECHSQSDSIVRAIHSVIQQYNKFEDLMPDFSICAHDRIKFVGEAIMLTTKHNTNWGKVVAMI 94 
9625972   1 MSSIKFQNIIENILKKCQDNRHSQDSVVRAVHSVIHQYNKFEALMPDFSLCVHDRIKFTGEAILLTTEHTTNWGKVVAML 80 
9631206  95 SFSVAALQTIDEDYRRVATSTLSSYIAKSVGVNWFIDHGGKKGLVEFCDTILSKSNVTFSVFLLPAILTVIILIGTLLIK 174
9625972  81 SFSAAVLQTIDEEYKCVATSMLSSYISRSVGANWFIENGGEKSLVEFCNSIMPQNPFNVLNFLVPAVLAGLVLMQTLLIK 160
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap