Conserved Protein Domain Family
PHA03158

?
PHA03158: PHA03158 
hypothetical protein; Provisional
Statistics
?
PSSM-Id: 165429
View PSSM: PHA03158
Aligned: 2 rows
Threshold Bit Score: 459.968
Threshold Setting Gi: 9625970
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
9631202   1 MDVATKLKTNLLyrisgpppvwINLKLGVILLLTLCPVVLTTSEYLPTPATSSQNVTQPSSWNVthtleatifstSRPNI 80 
9625970   1 MALDLRNLKHLT----------ANFSFRIMIWIMLCLALPTDSKPISTTEAPILNITQSPSLNI-----------SSPST 59 
9631202  81 SQTSENCTNCSTVLDLFWQQLGSGTSLKNLMLNLQLQEVIGlkwPKSSLPLAN-NVEAKAQKLQLPRNLPPTAVGPPNVK 159
9625970  60 LEPSEPLKNCTTFLDLLWQRLGENASIKDLMLTLQREEVHG---RMTTLPSPRpSSKVEEQQLQRPRNLLPTAVGPPHVK 136
9631202 160 YKFGNRWWEPPKGANVNGKKIKFDDPPLPYTGAYNEDGIRMVNVNGTHVRYQDLPFMERLKRSGPPWCLRTAKEKIPLVK 239
9625970 137 YRLYNRLWEAPKGADVNGKPIQFDDPPLPYTGAYNDDGVLMVNINGKHVRFDSLSYWERIKRSGTPWCIKTPSEKAAILK 216
9631202 240 QLLKSAKKCCKNTEHEKKLQEELEELQKSLAKT 272
9625970 217 QLLKAEKKCRTTSKRITELEEQIKELEKTSTSP 249
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap