Conserved Protein Domain Family
PHA03156

?
PHA03156: PHA03156 
hypothetical protein; Provisional
Statistics
?
PSSM-Id: 165427
View PSSM: PHA03156
Aligned: 2 rows
Threshold Bit Score: 135.881
Threshold Setting Gi: 9626009
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
9626009  1 MTWKLFICFLSFGVIFLRVSSLTEKSHTTSYTILhNNNFYSNSCSADTYVPSIKTFSSVWAILNVIIFFCASLFYLRHLC 80 
9631244  1 MVRGWFICWLIIFKTCLSAAQMTDTAATTSGAPL-NNNFYSYSCSADTFVPSIKTFSSIWAIVNGIIFFGASLLFLRHLC 79 
9626009 81 IVKFISNLTK 90 
9631244 80 FVRFISHLTK 89 
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap