Conserved Protein Domain Family
PHA03155

?
PHA03155: PHA03155 
hypothetical protein; Provisional
Statistics
?
PSSM-Id: 165426
View PSSM: PHA03155
Aligned: 2 rows
Threshold Bit Score: 164.126
Threshold Setting Gi: 9631243
Created: 9-Dec-2010
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
9626008   1 MASRRSCADVEELEKELQKLKIENKALKKKLVQhTSPEDELLTPAQKDAIINSTVNKLTKKAEEKIRERVLKDVLPLVSK 80 
9631243   1 MASGRASSDVEELQKELQKLKLENKALKKKMLQ-GNPEEEMLTPPQKEILINSLVSKLTKQAELKIRERVTKDLLPLVTK 79 
9626008  81 NQCMEAIAHIKYRIDVSIDETYNLSRRPASKPRTK 115
9631243  80 NQCMEAIADIKYRIDVSTKESQDRPRKTSCKLKTS 114
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap