Conserved Protein Domain Family
PHA03154

?
PHA03154: PHA03154 
hypothetical protein; Provisional
Statistics
?
PSSM-Id: 165425
View PSSM: PHA03154
Aligned: 2 rows
Threshold Bit Score: 633.649
Threshold Setting Gi: 9626006
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
9631240   1 MSRLYQPQRYSLISDLHKNYHYVDINVIKAELKNVKLDTVVTKFSQPATHLERGDFLLRMCQLLMIHREEEQEIINKAKS 80 
9626006   1 MSRPYQPQRYSLISELHKNFHYVDVSVIQSEFKNVILKTVVPKLSQPATHLEKGDFLLKICQLLMIHREEEQQILNKVKS 80 
9631240  81 NIIYFMNEILNTEYGEVKELAKNILCDVEIPKPNCELSAYLATTIPKLIVLKYPTHFRVCEEITPNGRWCLRNLLGIEPY 160
9626006  81 NIIYFLNELWSAEYGKVQEQVKNILCEVKLDKTDSELSTYLAQEIPKLTVLKYPTHFKVCEETIPNGRWCLHNLLGIEQY 160
9631240 161 YKYISDTVLLDPEISLGSVHAFSRLSKCLFWCESFMNKVYPSTAFNSSINQVVLWSTMFYLYSIAHYNEYVNESIGFTEA 240
9626006 161 YKDFSNIVLHDPETSLGSVQAYSRLSKLLFWCDSFMNKIYPCNAFNSSINQVVLWSTMFHFYSVAHCNDCISESISFTEA 240
9631240 241 LLKQEVTAFYNWCLEqEDYEADRMAKFIQFSANQITLTSTHTDLQGMAEYMYSYKKCFINRRFD 304
9626006 241 LLKQEVSAFYEWCLE-EEYEEDRMAKFMKFSADQITILSTHTDLQNLAEYIYSYKKCLINRRFE 303
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap