Conserved Protein Domain Family
PHA03152

?
PHA03152: PHA03152 
hypothetical protein; Provisional
Statistics
?
PSSM-Id: 165423
View PSSM: PHA03152
Aligned: 2 rows
Threshold Bit Score: 269.96
Threshold Setting Gi: 9626003
Created: 9-Dec-2010
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
9631238   3 MKWLLfGVLGCILSCKLLDAIRANPCCKIFALNETQIPSIYDINWIYITEPHTCGGFSIAQVLQRRSAQHQSTLYVCSNG 82 
9626003   1 MKWLL-GAYVCLCLANILNALIPNPCCNVFALNETLIPSIYDINWIYITDPQTCKGVSVAQVFQRRTAQHMSTRYVCSNG 79 
9631238  83 FNVISFLLAVLKKLPLNAEEQNLRNHLITLQNSFLSKLSTVTTGEQRFNRQHGQMVTT 140
9626003  80 FNVISFLLAVLRKLPLNTEEYNFKNRLITLQNSFLSKLGPDTTSAIKFKSKYGQLAKT 137
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap