Conserved Protein Domain Family
PHA03149

?
PHA03149: PHA03149 
hypothetical protein; Provisional
Statistics
?
PSSM-Id: 165420
View PSSM: PHA03149
Aligned: 2 rows
Threshold Bit Score: 123.608
Threshold Setting Gi: 9625994
Created: 9-Dec-2010
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
9631230  1 MGTLFSICKRRPNPLDTNGKVINLPDDFEELSETEIMLACPHETTPCKKNKETVYKTNQKYNKRDI 66 
9625994  1 MGTLCSVCKRRPNPVDTEGKVINVTDDFEEMSETEIMLACPQDKKLCKKPKESMYKTKHKSNKHGI 66 
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap