Conserved Protein Domain Family
PHA03147

?
PHA03147: PHA03147 
hypothetical protein; Provisional
Statistics
?
PSSM-Id: 165418
View PSSM: PHA03147
Aligned: 3 rows
Threshold Bit Score: 455.173
Threshold Setting Gi: 139472872
Created: 9-Dec-2010
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
9625983     1 MQEDIPNILYVSREEDGRIVEMIVTEKHKEKYVYYPYSNKSTFTIEDTKlfni-----------------anfsLIIQWI 63 
9631217     1 MPEEIPNILYVSREEDGRIVEMIMTEKYKNKYVYYPYNNHYKVAGEDTK-------------------------FIIWLI 55 
139472872   1 --MASSDILSVARTDDGSVCEVSLRGGRKKTTVYLPDTEPWVVETDAIKdaflsdgivdmarklhrgalpsnshNGLRMV 78 
9625983    64 TYTLFYSQAVIIFILYCWALNPYRSPGNSVLGGLGQRVPRTVVHINPHNIFEGCDKSIICKLRLPMPIINTTHGKIYPNF 143
9631217    56 TYFLFYIQAVIMLLFYYWTLNPYRDPGNGVMGGLGQRVPKTVVHINPEKIFEGCNNGILCETKLPMPIINTTHGEIFPNF 135
139472872  79 LFCYCYLQNCVYLALFLCPLNPYLVTPSSIEFA-EPVVAPEVLFPHPAEMSRGCDDAIFCKLPYTVPIINTTFGRIYPNS 157
9625983   144 TKT-GGSSANYKLALERLVGLMNNQQCNVEIISQKKTVFSSQNVTFFENVKSDAILALLVLQKNCHPESVEIVKSKIKLE 222
9631217   136 TKT-GGSPANYKLALEMLLGLMNNQQCNIEIISQKHKSFTAKNSTIFTNLKTNSILALLVLQKNCHPEIVEIVKEKIKLE 214
139472872 158 TREpDGRPTDYSMALRRAFAVMVNTSCAGVTLCRGETQTASRNHTEWENLLAMFSVIIYALDHNCHPEALSIASGIFDER 237
9625983   223 NYG--VNYRQHMPQYFTVCNASWADVINNTNYNFKTSDRPCNTNYLLRYPQHVPYIINVK 280
9631217   215 NYG--INYLQNMPQYFTECNASWSNVINNTSYSFKSSYKLCNINYLFRFTHHVPYIIKIK 272
139472872 238 DYGlfISQPRSVPS-PTPCDVSWEDIYNGTYLARPGNCDP------WPNLSTPPLILNFK 290
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap