Conserved Protein Domain Family
PHA03146

?
PHA03146: PHA03146 
helicase-primase primase subunit; Provisional
Statistics
?
PSSM-Id: 177543
View PSSM: PHA03146
Aligned: 6 rows
Threshold Bit Score: 1385.82
Threshold Setting Gi: 51557488
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
50313248     1 MAQRNPEPTIRVLYATDSCVITYSLMLLTGQ-ESSEGVYAISYDWSSELDDLFGRQprapntdaGDGWSSTEQSDADQLA 79  
9629799      1 MALNNPNPTIRVLYATDSCVITYSLMLLTGQ-ESSEDAYVISYDWSSELDDLFGSQprvldadvGDSWDTTDQSDEELLA 79  
216905860    1 MALRNPEPTIRVLYATDSCVITYSLMLLTGQ-ESSESVYAISYDWSSELDDLFGRQpralntdtGDGWSSTEQSDADQFA 79  
51557488     1 ----MPPSMIRVLYATDGCAITYSLMLLTGQ-EPSGAVYVVSYAWD------------------GAGLDEAFSLPGERAE 57  
9629822      2 DGPAALEDALQILYATDGCAIGFSLMLLTGQeEPGRGAYVVSYNWPGRLAACLGGE------------------SPNDVA 63  
296316008    2 DGPAALGDALRVLYATDGCAIGFSLMLLTGQeEPGRGAYVVSYDWPERLAACLGGE------------------GPDDVA 63  
50313248    80 TALLQRKPSVSFCLLSGMVGGASdEPQDRVRPMFVCVFSTWTGARALAMTLSHGHPLSSNTLLQALTEEATFLLHNDLIL 159 
9629799     80 AALLERKPSVSFCLLSGIVGGASdEPQERIRPMFVCAFLTLTGARALTKTLLHGHPISSKILLQALVDGDTFQLHNDLIL 159 
216905860   80 AALLQRKPSVSFCLLSGMVGGASdEPQDRVRPMFVCEFSTWTGARALAMTLLHGHPLSSNILLQALTEEATFLLHNDLIL 159 
51557488    58 AELLARRPGVTFCLTGH-------VASVRVRPVFVAA-----ATPAVVRALCRGEPLAARDVLEAMDEAATFALHDGLIA 125 
9629822     64 LALADARPLVAFYLLGGPPGGSA-AATPRLARLRVHLQQRAGRARARRRTAPRQGPTRARAA-RAPRRGRHLCAARGHDH 141 
296316008   64 QALAEARPLVAFYLLGGPPGGSA-AARPRAWPVFACAFNSARGARALADALLLGEPLPARVLLEHLAEDVTFALHADMIA 142 
50313248   160 ALAITTENVTARSGRTAAAAKYDPQRGSVKAAVIGHSTGRSGLTSVYIHHENKVLTAFRRLYCNNNTTPFWFASKFGPGE 239 
9629799    160 ALAITLDNATARTGRTAAAAKYDPQRGSVKAAILGHSTGRPGLTSVYIHHENKVLTAFRRLYSNNNTTPFWFTSKFGPGE 239 
216905860  160 ALAITTENVTARSGRTAAAAKYDPQRGSVKAAVICHSTGRPGLTSVYIHHENKVLTAFRRLYCNNNTTPFWFASKFGPGE 239 
51557488   126 ALTMVLEQVRPRTG----NAEYAPER-----PLRSIAVGRRGLTSLFVHHETQTLAAFRRLYGNHN-TPFWYVARFGPEE 195 
9629822    142 ALLVATEQLAPRTGRTADDARYVEGQTTVRSALRARPAGRRGLASLYIHHEHKTVAAYRRLYSNSGATPFWFLSKFGPGE 221 
296316008  143 ALLVTTEQLAPRAGRTADDAQYVEGQATVRSTLRARPAGRRGLASLYIHHEHKTVAAYRRLYANSGATPFWFLSKFGPGE 222 
50313248   240 REIVLATRYYLFQAIRcSRSGGTYDLQAVKDFIRTYNVPAAPNPTGLDLTHLTSFSLLSKFCCQSWYSRGPCALALPRYV 319 
9629799    240 RELVLATRYYLFQAIRhSGCGGTYDLQATKDFIKTYNVPCLPNPTNLDLTHLTSFARLSQFCCQSWYARGPSALALPRYV 319 
216905860  240 REIVLATRYYLFQAIRcSRSGGTYDLQAVKDFIRTYSVPAAPNPTGLDLTHLTSFSLLSKFCCQSWYSRGPCALALPRYV 319 
51557488   196 KTLVLATRLHLFHP------RPAYDLRALKDLLLTYNPRVDPNPSGLDPAGLLSFAALSRFCCLSGYARGPAAAHAARYV 269 
9629822    222 KTLVLATRFYVFQAER-AGDAATYDLQAVRDCLATYAVAAPPNPSGLAFPDLVSFAALAAFCCRSGYARGAVAAGAPAYV 300 
296316008  223 KTLVLATRFYVFQAER-AGDAATYDLQAVRDCLATYAVAAPPNPSGLAFPDLVSFAALAAFCCRSGYARGAVAAGAPAYV 301 
50313248   320 DLRIQADVAEVSALEGFIAADRQGLRVSDREFITYIYLAHFESFNRKQLYDHLLAVSIADPGDI----------DRITST 389 
9629799    320 DLRIQADVSEVSALEEFIAADRQGLRVSDREFITYIYLAHFESFNRRQLYNHLLAVSISDPADI----------ERITST 389 
216905860  320 DLRIQADVAEVSALEGFIAADRQGLRVSDREFITYIYLAHFESFNRKQLYDHLLAVSIANPADI----------ERITST 389 
51557488   270 DERVRADRAEMGVLRDYISHDRGSLKLPDREFVTYVYLAHFESFNRARLREHLDAVNVTDPAAP-------------VGR 336 
9629822    301 AARIEADLAEVRCLREYIDHDRRSLKVADPEFVAYVYLAYFEGFNRRQITEHLRAVTATEPPDGgea-----laPRLAGV 375 
296316008  302 AARIEADLAEVRCLREYIDHDRRSLKVADPEFVAYVYLAYFEGFNRRQITEHLRAVTATEPPAAagsgagaplaPRLAGA 381 
50313248   390 SSLKRGTIEKFFAQVRIQLNIRDYIAHNVNPRVVCLPASIGSQYAQDKTYTPSSTTMSTGSAP-LGVCDTSTPILKLLDR 468 
9629799    390 SSLKRGTIEKFFAQVRIQLNIIDYIAHNVSPEVVRLPVSISKQYVSDKTYTPSSTMMFAGNNP-LSICDTSTQMLKLLDR 468 
216905860  390 SSLKRGTIEKFFAQVRIQLNIRDYIAHNVNPRVVCLPASIGSQYAQDKTYTPSATTMSTGSIP-LGICDTSTPILKLLDR 468 
51557488   337 SPLGERAAAAFFRHVRAQLNIRDYVAQNVTPSVARLAPAMGAGYVEDRTYAAL-----AADAP-RGLCDAAAGLARRVTA 410 
9629822    376 SRLRERAVDAFFRHVRAQFNVQSYIEQNVAVAVVRLPPATAEAYARARTYARL--LAATANGPgRTICDGAAALRAALDH 453 
296316008  382 SRLRERAVDAFFRHVRAQFNVRSYIEQNVAVAVARLPPATAEAYARARTYARLAPAARTDGPPgRTVCEGATALRAALDR 461 
50313248   469 VESSLAGRGWIQ-----TIVSPNKPQSVHSTPPLDQSRGDELSPGVSSQCGISRRLLHIASSPPVNGRALPLEVLFGQKG 543 
9629799    469 VETSLAGHGWIQ-----TLIPSTKPQCITTTPPLDQPRGEELSPGVPSQCGISRRLLNIASSQPIDGRVLPLEVLFGQRG 543 
216905860  469 VEASLAGRGWIQ-----TVVSPNKPQSVNSSPPLDQSRGDELSPGVSSQCGISRRLLHIASSPPVNGRALPLEVLFGQKG 543 
51557488   411 VEERLAPHGWVR-----------------------APDEEQQQPGADG--AVLRRLLELAAAPGGGRARTALGALLGLPD 465 
9629822    454 LEGQAARFGWVLhapgaPSASAVPGPGLDAALRVGAPDGGASPDATPACCGVSKRLLELAAAAARDGAH-PLDGLFGARG 532 
296316008  462 LESQAARFGWVLhadgtPAGAAGAPLGPDAAPA--APDGAPPLDAAPACCGVSKRLLELAAAAARDGAH-PLDGLFGARG 538 
50313248   544 VPGPAPVYRVALPSKRQAFAVIANDRWETTTQNLARPGGsKQAYEGGFALAGFGEIDDCSLAWRDLQLTR---------- 613 
9629799    544 ISGPTPVYRVALPSKRQAFAVIANDRWETVTQNMYHQTY-RLASEHDLSFDGLSQMDDYAMAHRDLQLMR---------- 612 
216905860  544 VPGPTPVYRVALPSKRQAFAVIANDRWETTTQNLSRQGG-KPVYDGGLALAGFEEMDDCALAWRDLQLTR---------- 612 
51557488   466 ACPPAPVYRVELAHRRQAFAVLAGDAWGRATARRDAAPE----------------------------------------- 504 
9629822    533 TAAPTPVYRVELPRGHQAFAVADGDDWAAVTSVAALDPD-EVAVEVAAAAAAAAESGRDALVERDARLTAllte---raa 608 
296316008  539 TAVPAPVYRVELPRGHQAFAVADGDNWAAVTDVAALDPG-EVAAEVAAAVAAAAEGGRDALVERDARLTAllleraaaag 617 
50313248   614 -TTSGVCRTALASSNASAQMYINRNEIFNSSLAVSNIILDVDFGIKRRVPLGMLHLAMRGFRAGIITTLSLIFSDATVQ- 691 
9629799    613 -DDTGVCRAAMASSNASLQMYINRNEIFNSSLAVSNIILDVDFDIKKPIPLGMLHLAMRGFRNGIITTLSLIFTEAVVQ- 690 
216905860  613 -TNNGVGRTALASSNASAQMYINRNEIFNSSLAVSNIILDVDFGIKRRVPLGMLHLAMRGFRAGIITTLSLIFSDASVQ- 690 
51557488   505 ----------MAAHEPAAQMYVSRHEVFNARLAVTNIVLDVDFRLARPVPAGTLEAAMRGFRRAVLDALALLFPEADGD- 573 
9629822    609 cAAGRSDRRSLGPAAPRDQYYVNRNELFNARLAVTNIVLDVDFRLKRPLPRGDLHGAMRSFRRGALAALAALFPEIAADa 688 
296316008  618 sAGGGPHCLGPGPPAPREQYYVNRNELFNARLAVTNIVLDVDFRLRRPIPRGDLHGAMRSFRRGALAALAALFPEAAADa 697 
50313248   692 WDSYPCYFYKTSCPPQLVRALHRGEPSSFPDYVDGVEECYMESDFIDDYAAMEEytDGPMDDYEMMMVDNECPQAACDN- 770 
9629799    691 WDSYPCYFYKTQCPPQLFKARTKNEHSSLSNYVDCVEEYYMESNFLDDYAAMEEytYDLTDDYEMIVDDNECAQAVCDF- 769 
216905860  691 WDSYPCYFYKTSCPPKFSRALPRGEPSSLPDYVDGVEECYMESDLIDDYAAMEEytDEPMDYYEMMVDNE-YPQAACDN- 768 
51557488   574 WAAHPCYVYKSACPPGGALAAAAGSASAASSDDGLEEAPWDDDAALADFGAAPG--DEDWADWDAGVPAE---VYTCDDd 648 
9629822    689 WPAHPCFFYKSACPSAAASNLGDGDASPS-------------------WAAPDR--DAGWDEYESALAREGEAQYSCEDv 747 
296316008  698 WPAHPCFFYKSACPSAALRAGSASPS----------------------WDAPDR--DAGWDEYERALAREGEAQYGCEDv 753 
50313248   771 -----------TPPNKEGGKTPLQRLDDTDACECTEKMGFRVTVPVPPPYLLAGPEALRGLARIIQQAVVLERTFTESMC 839 
9629799    770 -----------KPQNKTTDKTPLQLLLETNACQCTEKMGFRITVPVPPPYILAGPEALRGVARIIQQAVVLERTFTESMC 838 
216905860  769 -----------TPQNKEGEKTPLQRLADTDACECTEKMGFRVTVPVPPPYLLAGPEALRGLARIIQQAVVLERTFTESMC 837 
51557488   649 evgvgiggaggDPGASALVRAPVP-ADERPPCGCRAKMGFRVCTPVPSPYAVAGADTVRGLARVLQQAVLLERDFIEPMG 727 
9629822    748 sdp-----agaRPEETGGAEGAGSAAALTTACGCDDKMGFRVAVPVPAPYIIAGGPTLKGIARLVQHAVMLERPFAEAMS 822 
296316008  754 gapa--darpgEPPGGAGAEDAGA-AALAAACGCEDKMGFRVAVPVPAPYLIAGGPALKGIARLVQHAVMLERPFAEAMS 830 
50313248   840 SVLRDFSFIDTGVYSHGRSLRLPFFCKVGDSGEVYGGLYPFYVIPPKCNDVDEFVAQHSNPANFHFHAAPR--HPTITHV 917 
9629799    839 SVLRDFSFLDTGVYSHGRSLRLPFFCKVGDSGEVYGGLYPFYVVPKNCNNVNEFIAEHSNPANFHFHASPR--SSTVTHV 916 
216905860  838 SVLRDFSFIDTGVYSHGRSLRLPFFCKVGDSGEVYGGLYPFYVIPPKCNAVDEFVAEHSNPANFHFHAAPR--HSTITHV 915 
51557488   728 PYLQDFTFVDTGVYAHGRSLRLPFFAKV-DGGGCHGRLLPFGDAPP----------GFDDPRNFHFHARP---AHAVTRV 793 
9629822    823 RYLRDFAFVDAAVYTHGHSLRLPFFGKPDAASNVGRWLLPFYVVPERCDDVAAFVAAHRDPHHFHFHAAPPagGRREARR 902 
296316008  831 RYLRDFAFVDAAVYTHGHSLRLPFFGKPGAAGGAERRLLPFYVVPERCADVAAFVAAHRDPHRFHFHAAPPagAPPRTHV 910 
50313248   918 ITDLGGDYVSFFERKVARNREAIMTKRATLESLLSSANVSIKSHEAVEAFVVDVVLGEVVSHLATHFPDQSGEYQTVGVH 997 
9629799    917 ITNLGGDYVSFFERKVARNREAIMTKRATLEFLLSSYNVSIKSNEAVEAFVVDVVLCEVVLHLSAHFPNHAGEYHTVGVH 996 
216905860  916 ITDLGGDYVSFFERKVARNREAIMTKRATLESLLSSANVSIKSHEAVEAFVVDVVLGEVVSHLATHFPDQAGEYQTVGVH 995 
51557488   794 LHSLGGEYESFFERKAARNREAFFARRTPLADMLRGLAVDAEDRRALEAFVADVAMAPVLRHLDAHFNGRAHEYAGATAQ 873 
9629822    903 AH-VGGEYVSFFERKAAVNRAAFHGVRVSLRRALAAVGVDGGDRGAVEEFIADVIEAELAPYMAEHYPQAAREYQGAGAR 981 
296316008  911 LRGVGGEYVSFFERKAAVNRAAFHGVRVSLRCALAAVGVAADNRGAVEEFIADAVEAELGPYMAEHYPQAAREYQGAGAR 990 
50313248   998 TVVTKPDWILMQINRSGN-AYRSQGFSCLRAKHLRSARGLARTFLSISADVHGRLCASISQQCFATKCGNNKMCTIFTLE 1076
9629799    997 TVVTKPDWILLQINRSGS-AYRSQGFSCLRAKHLRSARGLARTFLSISADAHGRLCASISQQCFATKCGNNKMCTIFTLE 1075
216905860  996 TVVTKPDWILMQINRSGN-AYRSQGFSCLRAKHLRSARGLARTFLSISADVHGRLCASISQQCFATKCGNNKMCTIFTLE 1074
51557488   874 RVVAKPDWVLFQLCGSAR-------FSCLRARHARSPP--ARTFVALSVDAHDRLCISLSQQCFATKCGSNATRTIFTAE 944 
9629822    982 LVAAKADWLLAQLVPARA--GTAQGFGCLRAAHGRAAQNKARSLVSLSVDSHDRLCASLIQQCFATKCGSNRLGTVFTVD 1059
296316008  991 LVAAKDDWLLAQLLPARArGAAAQGFGCLRAAHGRAAQNKARSLVSLSVDSHDRLCASLIQQCFATKCGSNRLGTVFTVD 1070
50313248  1077 VDRAK 1081
9629799   1076 VNRAK 1080
216905860 1075 VDRAK 1079
51557488   945 VGQSC 949 
9629822   1060 LSGRA 1064
296316008 1071 LSGRA 1075
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap