Conserved Protein Domain Family
PHA03145

?
PHA03145: PHA03145 
helicase-primase primase subunit; Provisional
Statistics
?
PSSM-Id: 165416
View PSSM: PHA03145
Aligned: 5 rows
Threshold Bit Score: 1860.43
Threshold Setting Gi: 83722622
Created: 9-Dec-2010
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
30984481    1 MAAAASPPVEVTALFATDGCVITSSIALLTNCAVGAEPLYVFSYDAY---LPDDPTGPASEKARYERSLALYRASGGLSG 77  
9629323     9 EGRSVAAPVEVTALYATDGCVITSSLALLTNCLLGAEPLYIFSYDAYrsdAPNGPTGAPTEQERFEGSRALYRDAGGLNG 88  
9629434    10 ERRAAGTPVEVTALYATDGCVITSSIALLTNSLLGAEPVYIFSYDAY---THDGRADGPTEQDRFEESRALYQASGGLNG 86  
56694776    4 EASLAGPQVEVTALYATDGCVITSSIALLTNCTLGAEPLYVFSYDAY---LPDDPPGTASEKARYERSLALYRPSGGLSG 80  
83722622    4 EDPPARPPVEVTALYATDGCVITSSIALLTNCALGAEPLYVFSYDAY---LPDDPPGTASEEARYERSLALYRPSGGLSG 80  
30984481   78 EAFRVTFCLLGTEAGGVGHharARTRVRPMFVCRFERADDVAALQEALGRGAPLAPAHVARTLDAEATFAIHTPLILALT 157 
9629323    89 DSFRVTFCLLGTEVGVTHH---PKGRTRPMFVCRFERADDVAVLQDALGRGTPLLPAHVTATLDLEATFALHANIIMALT 165 
9629434    87 DSFRVTFCLLGTEVGGTHQ---ARGRTRPMFVCRFERADDVAALQDALAHGTPLQPDHIAATLDAEATFALHANMILALT 163 
56694776   81 ETFRVTFCLLGTEAGGVGHharARGRVRPMFVCRFERADDVAALQEALGRGAPLAPAHVARTLDAEATFAIHTPLILALT 160 
83722622   81 ETFRVTFCLLGTEAGGVGHrarARGRVRPMFVCRFERADDVAALQEALGRGAPLAPAHVARTLDAEATFAIHTPLILALT 160 
30984481  158 VAVNGASA-RTGRTAAAAEYAPGESLRSLVARAPLGQRGLTTLFVHHEARVLAAYRRAYYGSAQNPFWFVTKFGPDEKSL 236 
9629323   166 VAIVHNAPaRIGSGSTAPLYEPGESMRSVVGRMSLGQRGLTTLFVHHEARVLGAYRRAYYGSAQSPFWFLSKFGPDEKSL 245 
9629434   164 VAINNASP-RTGRDAAAAQYDQGASLRSLVGRTSLGQRGLTTLYVHHEVRVLAAYRRAYYGSAQSPFWFLSKFGPDEKSL 242 
56694776  161 VAVNGAGP-RTGRTAAAAEYAPGESLRSLVARAPLGQRGLTTLFVHHEARVLAAYRRAYYGSAQNPFWFVSKFGPDEKSL 239 
83722622  161 VAVSGAGP-RTGRSAAAAEYAPGESLRSLVARAPLGQRGLTTLFVHHEARVLAAYRRAYYGSAQNPFWFVSKFGPDEKSL 239 
30984481  237 VLVARYYLLQALRLGGAGATYDLQAIKDVCATYAVPHVSRADAPSAAALTSFAAVTRFCCTSQYARGPAAAGFPLYVERR 316 
9629323   246 VLAARYYLLQAPRLGGAGATYDLQAVKDICATYAIPHDPRPDTLSAASLTSFAAITRFCCTSQYSRGAAAAGFPLYVERR 325 
9629434   243 VLTTRYYLLQAQRLGGAGATYDLQAIKDICATYAIPHAPRPDTVSAASLTSFAAITRFCCTSQYARGAAAAGFPLYVERR 322 
56694776  240 VLVARYYLLQALRLGGAGATYDLQAIKDVCGTYAVPHVPRADAPGAAALTSFAAVTRFCCTSQYARGPAAAGFPLYVERR 319 
83722622  240 VLVARYYLLQALRLGGAGATYDLQAIKDVCATYAVPHAPRADAPGAAALTSFAAVTRFCCTSQYARGPAAAGFPLYVERR 319 
30984481  317 IAADVRETGALKEFIAHDRGCLRVSDREFITYIYLAHFECFSPPRLAGHLRAVTTRDPDPAAATDRPSGLGREAVERFFS 396 
9629323   326 IAADVRETGALEKFIAHDRSCLRVSDREFITYIYLAHFECFSPPRLATHLRAVTTHDPSPAASTEQPSPLGREAVEQFFR 405 
9629434   323 IAADVRETSALEKFITHDRSCLRVSDREFITYIYLAHFECFSPPRLATHLRAVTTHDPNPAASTEQPSPLGREAVEQFFC 402 
56694776  320 IAADVRETGALKEFIAHDRGCLRVSDREFITYIYLAHFECFSPPRLAGHLDAVTTRDPDPAAATDRPSGLGREAVERFFS 399 
83722622  320 IAADVRETGALKEFIAHDRGCLRVSDREFITYIYLAHFECFSPPRLAGHLDAVTTRDPDPAAATDRPSGLGREAVERFFS 399 
30984481  397 HVRAQLNIREYVRQNVTPREAVLRGATAEAYLRARTYAPAALEAAPRYRGAVDSATGMLGRLAEAERLLVPHGWP-GGPP 475 
9629323   406 HVRAQLNIREYVKQNVTPRETALAGDAAAAYLRARTYAPAALTPAPAYCGVADSSTKMMGRLAEAERLLVPHGWPaFAPT 485 
9629434   403 HVRAQLNIGEYVKHNVTPRETVLDGDTAKAYLRARTYAPGALTPAPAYCGAVDSATKMMGRLADAEKLLVPRGWPaFAPA 482 
56694776  400 HVRAQLNIREYVRQNVAPREAVLRGAVAEAYLRARTYAPAGLEPAPRYRGAVDSSTGMLGRLAEAERLLTPHGWP-AAPP 478 
83722622  400 HVRAQLNIREYVRQNVTPREAVLRGAVAEAYLRARTYAPAGLEPAPRYRGAVDSATGMLGRLAEAERLLVPHGWPgAAPP 479 
30984481  476 RPAEGEGGAGAPA-GCGIVRRLLRLAATEPGAEAPPAIAALTQDARTQTPLPVYRVAMAPRGQAFAALARDDWDRISRDA 554 
9629323   486 TPGDDAGGGTAAPqTCGIVKRLLKLAATEQQGTTPPAIAALMQDASVQTPLPVYRITMSPTGQAFAAAARDDWARVTRDA 565 
9629434   483 SPGEDTAGGTPPPqTCGIVKRLLRLAATEQQGPTPPAIAALIRNAAVQTPLPVYRISMVPTGQAFAALAWDDWARITRDA 562 
56694776  479 KAGEGDGGAGAAP-GCGIVRRLLRLAATESHADTPPAIAALTRDGRTQTPLPVYRIAMAPRGQAFAALARDDWDRVTRDA 557 
83722622  480 KAGEGDGGAAP---GCGIVRRLLRLAATEPRADTPPAIAALTRDGRTQTPLPVYRIAMAPRGQAFAALARDDWERITRDA 556 
30984481  555 RLSAADVSAAAAAAApDPGALGLRLTWRVHARNPVTaPSTGPTAAGQMYVNRNEIFNGDLAVTNIILDLDVALREPIPFE 634 
9629323   566 RPPEATVVADAAAAP-EPGALGRRLTRRICARGPAL-PPGGLAVGGQMYVNRNEIFNAALAVTNIILDLDIALKEPVPFP 643 
9629434   563 RLAEAVVSAEAAAHP-DHGALGRRLTDRIRAQGPVM-PPGGLDAGGQMYVNRNEIFNGALAITNIILDLDIALKEPVPFR 640 
56694776  558 RLSAADVAAAAGASPrDPGALGLRLTWRVHARNPVTaPSTAPTAAGQMYANRNEIFNGGLAVTNVVLDLDVALREPIPFE 637 
83722622  557 RLPAADVAAAVGAFPrDPGALGLRLTWRVHARNPVTaPPTAPTAAGQMYANRNEIFNGGLAVTNVVLDLDVALREPIPFE 636 
30984481  635 RLHVALGHFRRGALAAVALLFPGARVDPDAYPCYFFKSACSPRAVRGDPGLGPD-GEY-GEAPWAPPGGAGENAwEDDDD 712 
9629323   644 RLHEALGHFRRGALAAVQLLFPAARVDPDAYPCYFFKSACRPRAPPVCAGDGPSaGGDdGDGDWFPDAGGPGDE-EWEED 722 
9629434   641 RLHEALGHFRRGALAAVQLLFPAARVDPDAYPCYFFKSACRPGPASVGSGSGL---GNdDDGDWFPCYDDAGDE-EWAED 716 
56694776  638 RLHGALGHFRRSALGAVALLFPAARVDPDAYPCYFFKSACRPRVAARDPGLGGD-EEY-GDGPGVGAG-------DDDGD 708 
83722622  637 RLHGALGHFRRSALGAVALLFPAARVDPDTYPCYFFKSACRPRVAARDPGLAGG-GEYdGDGPGGPAGD------DDDGD 709 
30984481  713 PDAEALARGG-VDEEAAYLDALHETPTAtaPAAATSESPRCTCAKKIGLRVCLPVPAPYVVSGSLTMRGVARVIQQAVLL 791 
9629323   723 TDPMDTTHGPlPDDEAAYLDLLHEQIPA--ATPSEPDSVVCSCADKIGLRVCLPVPAPYVVHGSLTMRGVARVIQQAVLL 800 
9629434   717 PGAMDTSHDP-PDDEVAYFDLCHEVGPT--AEPRETDSPVCSCTDKIGLRVCMPVPAPYVVHGSLTMRGVARVIQQAVLL 793 
56694776  709 PDAEALASGG-VDEEAAYLDALHEPPPAe-AASAPPESPRCTCAQKIGLRVCLPVPAPYVVFGPTTMRGVARVIQQAVLL 786 
83722622  710 PDAEALAYGG-VDEEAAYLDALHELPPAeaAASAPPESPRCTCAQKIGLRVCLPVPAPYVVSGPTTMRGVARVIQQAVLL 788 
30984481  792 DREFVEAVGGYVRDFLLVDTGVYAHGHSLRLPYFAKVTDEGLACGRLLPVFVVPPACPDVPAFVAAHADPRRFHFHAPPA 871 
9629323   801 DRDFVEAVGSHVKNFLLIDTGVYAHGHSLRLPYFAKIGPDGSACGRLLPVFVIPPACEDVPAFVAAHADPRRFHFHAPPM 880 
9629434   794 DRDFVEAIGSYVKNFLLIDTGVYAHGHSLRLPYFAKIAPDGPACGRLLPVFVIPPACKDVPAFVAAHADPRRFHFHAPPT 873 
56694776  787 DRDFVEAVGGYVRDFLMVDTGVYAHGHSLRLPYFAKVTDEGLACGRLLPVFVVPPACRDVAAFVAAHADPRRFHFHAPPA 866 
83722622  789 DRDFVEAVGGYVRDFLMVDTGVYAHGHSLRLPYFAKVTDEGLACGRLLPVFVVPPACPDVAAFVAAHADPRRFHFHAPPA 868 
30984481  872 TAPDAGELRVLHSLGGDYISFFERKAFHNAIEHFGRRETLAEVLGRYDARLGVGDTVEAFALELLGRILACLETHFPEHV 951 
9629323   881 FSAAPREIRVLHSLGGDYVSFFEKKASRNALEHFGRRETLTEVLGRYDVRPDAGETVEGFASELLGRIVACIEAHFPEHA 960 
9629434   874 YLASPREIRVLHSLGGDYVSFFERKASRNALEHFGRRETLTEVLGRYNVQPDAGGTVEGFASELLGRIVACIETHFPEHA 953 
56694776  867 TAPDAGELRVLHSLGGDYISFFERKASHNAIEHFGRRESLAEVLGRYDARLGVGETVEAFALELLGRVVACLETHFPEHA 946 
83722622  869 AAPPAGELRVLHSLGGDYISFFERKASHNAIEHFGRRETLAEVLGRYDARLGAGETVEAFALELLGRIVACLETHFPEHA 948 
30984481  952 HEYQSVSVQRALVQDNRALLQLVPSRGGFQHGLSCLRFKHGRNSRATARTFLALSVGARNGLCVSLCQQCFASKCDSNRL 1031
9629323   961 REYQAVSVRRAVIKDDWVLLQLIPGRGALNQSLSCLRFKHGRASRATARTFLALSVGTNNRLCASLCQQCFATKCDNNRL 1040
9629434   954 GEYQAVSVRRAVSKDDWVLLQLVPVRGTLQQSLSCLRFKHGRASRATARTFVALSVGANNRLCVSLCQQCFAAKCDSNRL 1033
56694776  947 HEYQSVSVQRALVQDDRALLQLVPSRGGPQHGLSCLRFRHGRGSRATARTFLALSVGARNGLCVSLCQQCFASKCDSNRL 1026
83722622  949 HEYQSVSVQRAVVQDDRALLQLVPSRGGLQQGLSCLRFRHGRSSRATARTFLALSVGARNGLCVSLCQQCFASKCDSNRL 1028
30984481 1032 RTLFTVDAGpPPCSPCAPSGTSPPSAS 1058
9629323  1041 HTLFTVDAG-TPCSRSAPSSTSRPSSS 1066
9629434  1034 HTLFTIDAG-TPCSPSVPCSTSQPSS- 1058
56694776 1027 RTLFTVDADpPPCSPCAPCGTSPPSAS 1053
83722622 1029 RTLFTVDAGpPPCSPCAPCGTSPPSAS 1055
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap