Conserved Protein Domain Family
PHA03141

?
PHA03141: PHA03141 
helicase-primase primase subunit; Provisional
Statistics
?
PSSM-Id: 177540
View PSSM: PHA03141
Aligned: 5 rows
Threshold Bit Score: 146.819
Threshold Setting Gi: 9628044
Created: 9-Dec-2010
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
9628044    1 MPSYHAHRHETKFWLVDRAFAAGRPeRAPPMPVDCLRPAPYLLIGEGAVCWHEALDLPLDVDFAAYLSETLSCVSAAlap 80 
13095618  73 LGLYYVHRSDTQFWLLPRDYVTQKV-HRPVYPTDCLAPQKFLLTTNGPMCWLPTQPMPSNIHFNAYLNFILQILYRA--- 148
9625997   63 LQLYFKNRHNAKFWLVPQHFLTSKP-QKPNIPSDCVAPTLFFFTTDGPLCWHQKLNVPLNINYEEYIHKAITVFEKV--- 138
9631233   62 LPLYFENRHNAKFWLVPKIFLTSLP-QKPHIPSDCISPTLFFFTTEGPVCWHQKQNVPININYGEYLHRALLVFEKV--- 137
18653848 102 LPTLFANRRCVNFWLLPRAWVKSAP-ICPPLPIDCVTPPQFVVTKRGPICWYKEWPLPVDVDFMYYLQEALCVFSVVs-- 178
9628044   81 pggGGEAGEGRNNTDHCLEEFKSVLSLL 108
13095618 149 ---IGKVYTTNMETEKKLNGFVKILNLF 173
9625997  139 -----PSLTINKDMYIKIESWKNILCLL 161
9631233  138 -----PNVTIDKEICNRVEGWKNILHLL 160
18653848 179 ---NGEGTESHADNIRQLEKFEKVLCLF 203
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap