Conserved Protein Domain Family
PHA03139

?
PHA03139: PHA03139 
helicase-primase primase subunit; Provisional
Statistics
?
PSSM-Id: 165411
View PSSM: PHA03139
Aligned: 3 rows
Threshold Bit Score: 1694.4
Threshold Setting Gi: 51874265
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
9633114    1 MTIVVFATEYDAANVIFSILCRSPSEHLIFPIIVKYKPSNNVSFCLQTQKCKNSKRIDTVFVCHAEKLNLSHYIQTASPI 80 
9628345    1 MTIVVFATEYDAANVIFSILCRSPSEHLIFPIIVKYKPSNNVSFCLQTQKCKNSKRIDTVFVCHAEKLNLSHYIQTASPI 80 
51874265   1 MTITVFATEYDPAHVIVNILCKNPSEHLIFPIIVKYKPSKNVYFCMQTQKCKFSKRIETVFVCDAESLNFSYYVKNALPI 80 
9633114   81 KAEDVANSLNDKETELLYVDMILSQTGKEKEDVEFKYMAYFHKSLIIKYLTGKFLLPTSPFWFLSTYGQTEGLLLLTMYY 160
9628345   81 KAEDVANSLNDKETESLYVDMILSQTGKEREDVEFKYMAYFHKSLIIKYLTGKFLLPTSPFWFLSTYGQTEGMLLLTMFY 160
51874265  81 KSEDIIHCLNTEETENLYKDFLLSHVPEGSENIEFKSLVFFCKTIIIKHLTNKYLLPTSPFWFLSTYGQTEGMLLLTMYY 160
9633114  161 YLFEEQKSTITTTKNYVQCFTENTGSMVFTYSSMSEFINITLKSKFRKLFADFATYARQKNLRDKEEFKYLDTQINLFRK 240
9628345  161 YLFEEQKSTITTTKNYVQCFTENTGNMVFTYSSMSEFINITLKSKFRKLFADFSTYARQKNLRDKEEFKHLDTQINLFRK 240
51874265 161 YLFEEQKSTIATTKNYVQCFTDKLGDMVFTYSSMSEFINITLKSNYRKKFVSFSEYAKQKNIRDRKEFLYLDKQIDIFRN 240
9633114  241 SSHLTNTFRVHYIYIAYNTALETTKFVNYCNITSYDSNLPIGQQCQRNVHILGNSLHENLLCIMKQYFNADCYFKTYIDI 320
9628345  241 SSHLTNTFRVHYIYIAYNTALETTKFVNYCNLTSYDSNLPIGQQCQRNLHILGNSLHENLLCIMKQYFNADCYFKTYIDI 320
51874265 241 SVHLTNSFRVHYIYIAYSTALEKNKFIKYSQLTSYDPTRSDTSQCQENMYILGNSLHSDLISIMKQYFNEDSYFQNYVEI 320
9633114  321 KRLKNPDLNVTEYEYALASKKKTIQALTSEQITRAIAKCNKNGEGLFSPVKPGLQGLLEISASDKYVQIQDKRIYRRQHL 400
9628345  321 KRLKNPNLNVTEYEYALVSKKKTIQALTSEQITRAIAKCNKNGEGLFSPVKPGLQGLLEISASDRYVQIQDKRIYRRQHL 400
51874265 321 KRMLNNKFQMQQYVYDINSNRNIMLVINSDQISKMVNKCNKHGEGYFTPIKLGLQGFLKILASNKSILIDGKPVTRRQYL 400
9633114  401 HKDYHRPFPVFRVQLLHKNIFCFGNSEDWYENMGFNRILQYLPDEYISDEALTRAIWLQDTHFLCDDFEKQFYTTRHEIF 480
9628345  401 HKDYHRPFPVFRVQLLHKNIFCFGNSEDWYENMGFNRILQYLPDEYISDEALTRAIWLQDTHFLCDDVEKQFYTTRHEIF 480
51874265 401 HDQFSNPIPMFRVQMSYKNLYCFGSAESWYKNMGFDQVMQFLPNEYISDESLTSTFWLQDTTFLSDEIEKQFYVTRHEIF 480
9633114  481 NERIPVTNYIGDLDLPLQDTATITEETFFSMCRLIRLTLINAWKKIFPSIDTHTHPIFFFKTQCDTTNDALDYTEDPTEI 560
9628345  481 NERIPVTNYIGDLDLPLQDTATITEETFFSMCRLIRLTLINAWKKIFPSIDTDTHPIFFFKTQCDTTNDTLDYTEDPTEI 560
51874265 481 NEYLPVTNYIGDLDLPLQDSAIITESLFFSMCKLMRNVLINAWQKIFPFIDKDAYPIFFFKTTCSNPENPLNHNVCYNEV 560
9633114  561 KQ-FCICRKKIGLRISIPLPNGTAIAGGEPLKQLSKILNHVMCLDQELSQILNSLTFPGECFDIGIYHTGHCIRIGYMYK 639
9628345  561 KQ-FCVCRKKIGLRISIPLPNGTAIAGGEPLKQLSKILNHVMCLDQELSQILNSITFPGECFDIGIYHTGHCIRIGYMYK 639
51874265 561 ETaFCVCKKKIGLRIAIPIPQGTAIIGSEPLKQLSKIFNHLMCLNHDLMQILNSVIFPGECFDTGIYNTGRCLRLGFMYK 640
9633114  640 TDMDKGKMLHGRLTPIFIVPEGYRNSCKTFIQMQMDLNNLLHHGTKKAPIEELIYSITDKGCPKENLSFMDLKSRQLWNK 719
9628345  640 TDMDKGKMLHGRLTPIFIVPEGYRNSCKTFIQMQMDLNNLLHHGTKKAPIEELIYNITDKGCPKENLSFMDLKSRQLWNK 719
51874265 641 VDEENNRFLYGRLKPIFIVPEKMKKNFQDFVSMQLDLNNILHHGTKDQTITEIIYSIFDKACPTE-FSFIDSRTKQLYHR 719
9633114  720 VNIATDTLITKYLNTHGFNNNAT-SADDSLLSFIRLIGWPIIKTQLITHYETRIAQQFSQVTFLKIDSKNLQIKKTQFGR 798
9628345  720 VNIATETLITKYLNTHGFNNNAT-SADDSLLSFIRLIGWPIIKTQLITHYETRIAQQFSQVTFIKIDSKNLQIKKTQFGR 798
51874265 720 KQSSLETLCLKYLHVNGFSETSClSRDDLLMTFTRSIAWPQMLKKNIQHCEARTATQFQHVTFLKIDHKNIQLKKLQNGK 799
9633114  799 VSDFSCLNRQHRGNRDNVLVYIQLKADGNRLILILWSTCFATKCQSNSKQVHCSIALEQLKN 860
9628345  799 VSDFSCLNRQHRGNRDNVLVYIQLKADGNRLILILWSTCFATKCQSNSKQVHCSIALEQLKN 860
51874265 800 LSDFSCLTRNHKGNRENVLVYLEFKVDNNRILIILWSKCFTTKCKSNSKQVHSSVVLDSLNM 861
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap