Conserved Protein Domain Family
PHA03138

?
PHA03138: PHA03138 
thymidine kinase; Provisional
Statistics
?
PSSM-Id: 165410
View PSSM: PHA03138
Aligned: 2 rows
Threshold Bit Score: 681.7
Threshold Setting Gi: 9625911
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
9625911    1 MSTDKTDVKMGVLRIYLDGAYGIGKTTAAEEFLHHFAITPnrILLIGEPLSYWRNLAGEDAICGIYGTQTRRLNGDVSPE 80 
13242429   2 AQHGTCRDPVCITRVYLEGAFGIGKTTTALAFVNGSRVNP--VFFIGEPMMYWRNMAGDDAINGIYGTQVRRKNGEISDN 79 
9625911   81 DAQRLTAHFQSLFCSPHAIMHAKISALMDTSTSDL-VQVNKEPYKIMlsDRHPIASTICFPLSRYLVGDMSPAALPGLLF 159
13242429  80 DAQRLTAYFQGLFCSPHSMLHARILHLTVQNPNNLaLKFFNNPVAIF--DRHPVASNVCFPISRYVVGDMTPATLPGFLF 157
9625911  160 TLPAEPPGTNLVVCTVSLPSHLSRVSKRARPGETVNLPFVMVLRNVYIMLINTIIFLKT-NNWHAGWNTLSFCNDVFKQK 238
13242429 158 AVSEEPEGTNLIVCTVSLTNHLTRITNRSRSGEIIDVQFILVLRNVYIMLINTIRYLQAkSDWLIDWFKLPFCSNSFKQQ 237
9625911  239 LQKSECIKLREVPGIEDTLFAVLKLPELCGEFGNILPLWAWGMETLSNCSRSMSPFVLSLEQTPQHAAQELKTLLPQMTP 318
13242429 238 LQEKECITIQENPVIENTLFAVFKIPELCDSYGELLDLWKWGMGVLANRLKNISCYVLSLDTTPTDAVIELCKQLPNMTV 317
9625911  319 ANMSSGAWNILKELVNAVQD 338
13242429 318 SYLVPGGLAYLQEMSDSVNL 337
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap