Conserved Protein Domain Family
PHA03136

?
PHA03136: PHA03136 
thymidine kinase; Provisional
Statistics
?
PSSM-Id: 177538
View PSSM: PHA03136
Aligned: 2 rows
Threshold Bit Score: 658.705
Threshold Setting Gi: 255683191
Created: 9-Dec-2010
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
57790948    1 MAVAGAVK-------TSGGVQFCsefenddsdfrrVVLLYVDGPFGVGKTVTAKTLMQmpNWRGCRLYLAEPMQAWRQWF 73 
255683191   1 MSLRDSCErlirrafSVPSMPLC------------LVRVYLDGPYGTGKTTTGKLLSE--DTLAATLYVAEPMAYWRNHF 66 
57790948   74 ggADMIKEINEIQTLKASGKLECREASPVAVAeVQMTIAAPLRIMNHVIYNYLGSErcysAAASGPDDVLFLVDRHPLAA 153
255683191  67 --EDVIKGVYETQERKARGDIATTDAKAITAA-LQLQFFAPYSSFHTYASTLFGVE----APERTPPDITLIIDRHPTAA 139
57790948  154 CLCFPVAQYLSGALEFGDLITLLSGIPDIPTHSNIVLMDLDICEQARRIIQRGRPGETVDWTYLCALRNSYICLMNTTTY 233
255683191 140 CLCFPAARFVVGDMSLSTLLAMISLIPREPHGGNIVIMDLNEDEHLERLRARQRPGEAIDVRFLRVLHNIYKMFVNTIWY 219
57790948  234 LQRTS--YPALLKEQEALTSATLLKFKRECLETATVPEI-----NPSIDQTLFAILAFDQQNVHGERLKTVLSFVVQKLA 306
255683191 220 AKQAPimWDCDKWDKDWSSVPIFDDDRKKMLEARDSVPIvggkkRPSPSTTLLSLFKVPELCDESFRLRKVHEWNLRCAL 299
57790948  307 TVLKNLCIFYLPAHGLTPEACALKCLEFAETASSLTTKRAAIASLIDAVERYNADMGS 364
255683191 300 IKLADLNAYFMDISGKSPQECAAEVREATNAMDFTRLSFTMAGDLEQAVNQYNTEMTI 357
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap