Conserved Protein Domain Family
PHA03135

?
PHA03135: PHA03135 
thymidine kinase; Provisional
Statistics
?
PSSM-Id: 165407
View PSSM: PHA03135
Aligned: 3 rows
Threshold Bit Score: 677.804
Threshold Setting Gi: 12084852
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
12084852    1 MALPRRPPTLTRVYLDGPFGIGKTSILNAMPDHTPDGAPILKVYEPMKYWRCQSTDLVVAANETPERRRGGALSRFQSDM 80 
10834893   10 MPSQMTSAQLIRVYLDGPLAIGKTSMLNEVPSHSATGVPVLKVFEPLKYWRRYFTDLVAAVNDASERRRRGELSLFQSSM 89 
125745075  10 MASQMTSAQLIRVYLDGSMGIGKTSMLNEIPTHSLMGVPVLKVFEPMKYWRYYFTDLVTTVNDTCDRRRRGEFSLFQSSM 89 
12084852   81 IMASIQARFADPYLLFHERLSSKCRGKIEICDTPAIILMLDRHPVAAILCFPITRYLLGEYSLEMLISSIIRLPLESPGC 160
10834893   90 IVMALQAKFADPFIVLHERISSKCHQLAGTRGNPSLILIVDRHPVSATVCFPIARHLIGDCSLEMLISAITRLPHEPPGC 169
125745075  90 IVTALQSKFADPYLVFHERLSSKCHRITGTRGNPSLILILDRHPISATVCFPIARHLTGDCSLEMLISMIIRLPQEPPGC 169
12084852  161 NLTVTILPDEKEHVNRICSRDRPGETADRNMLRTLNAVYASLVDTVKYANLTCPYEKESWEMEWLGLPWFEESLLEEFIS 240
10834893  170 NLVIAHLPDETEHLKRLSARNRAGETTDVRMLRALNAAYSALADTVAYANCICPYSKDEWETEWMQLPWFDASMASTFID 249
125745075 170 NLVIVDLHDEKEHVSRLSSRNRTGEKTDLLMLRALNAVYSCLVDTIMYANHICPYSKDEWESEWLDLPWFDTSLATTFIN 249
12084852  241 RPRPViCSRTRMPLDRTLLAIFKRKELCSENGELLTQYSWILWGLLTKLHTINVELFDISGMSRRECASAIMHTMPERLS 320
10834893  250 GPRSG-YHGSRVSLQHTLLPIFKRKELCSEDGSLLTVYGWILWGMLMKLRNINVERLDVSDMSVQKCAEYLMDSMAERLI 328
125745075 250 EPRTD-YRGSRVSLHHTLLAIFKRRELCAEDGSLSTTHAWILWGLLMKLRNINVERFNITGLSTTKCVESFMDTMSERLV 328
12084852  321 TLASWNDLCELEDDVISYNKGMCN 344
10834893  329 THMSWNDVFEIEADVQAFNKEMDI 352
125745075 329 THMSWNDAFEIEADVLAYNKEMAM 352
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap