Conserved Protein Domain Family
PHA03134

?
PHA03134: PHA03134 
thymidine kinase; Provisional
Statistics
?
PSSM-Id: 177537
View PSSM: PHA03134
Aligned: 7 rows
Threshold Bit Score: 421.517
Threshold Setting Gi: 296316038
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
296316038   1 MAEPSKPAPALRVVRVYLDGAHGLGKTTTGRALAAAASaAGGPVLFFPEPMAYWRTMFPTDALSGILaaSARRAAAQGGR 80 
9629765    13 SASGTPTRRQVTIVRIYLDGVYGIGKSTTGRVMASAAS-GGSPTLYFPEPMAYWRTLFETDVISGIY--DTQNRKQQGNL 89 
51557518    1 ----------MRILRIYLDGAYGTGKSTTARVMALGGA------LYVPEPMAYWRTLFDTDTVAGIY--DAQTRKQNGSL 62 
50313280   13 SASGAPVRRQVTIVRIYLDGVYGIGKSTTGRVMASAAS-GGSPTLYFPEPMAYWRTLFEADVISGIY--DTQNRKQQGDL 89 
216905892  13 SASGAPARRQVTIVRIYLDGVYGIGKSTTGRVMASAAS-GGSPTLYFPEPMAYWRTLFEADVISGIY--DTQNRKQHGDL 89 
270339476   8 VQNEEIIKSQVNTVRIYIDGAYGIGKSLTAKYLVRADEnRPGYTYYFPEPMLYWRSLFETDVVGGIY--AVQDRKRRGEL 85 
9629852     1 ---MAEPARALRVVRIYLDGAHGLGKTTTGRALAAAST-AGEGVLFFPEPMAYWRTMFGTDALSGIL--AASARCAAASH 74 
296316038  81 ------------ADADAAGLVAYYQARFAAPYLVLHARVAALLAPPEPAPGGDDVVTLVFDRHPLAACLCYPFARYCLRE 148
9629765    90 ------------AVDDAALITAHYQSRFTTPYLILHDHTCTLFGGNSLQRGTQPDLTLVFDRHPVASTVCFPAARYLLGD 157
51557518   63 ------------SEEDAALVTAQHQAAFATPYLLLHTRLVPLFGP---AVEGPPEMTVVFDRHPVAATVCFPLARFIVGD 127
50313280   90 ------------AADDAASITAHYQSRFTTPYLILHDHTFGLFGGDSLQRGTRPDLTVVFDRHPVASAVCFPAARYLIGD 157
216905892  90 ------------AADDAASITAHYQSRFTTPYLILHDHTFGLFGVDSLQRGTRPDLTVVFDRHPVASAVCFPAARYLIGD 157
270339476  86 ------------SAEDAAYITAHYQARFAAPYLLLHSRLSTITGYQKVVCEEHPDVTLIIDRHPLASLVCFPLARYFVGD 153
9629852    75 gsargaggpahrADADAAGLVAYYQARFAAPYLILHARVSALLAPPGPAPGG--TVTLVFDRHPVAACLCYPFARYCLRE 152
296316038 149 INAEDLLALAATAPLEAPGANLVVCTLPPAEQQRRLAARARPGDRADAGFLAAVRNAYALLANTCAFLGAGGAWRDGWDA 228
9629765   158 MSMCALMAMVATLPREPQGGNIVVTTLNVEEHIRRLRTRARIGEQIDITLIATLRNVYFMLVNTCHFLRSGRVWRDGWGE 237
51557518  128 ISAAAFVGLAATLPGEPPGGNLVVASLDPDEHLRRLRARARAGEHVDARLLTALRNVYAMLVNTSRYLSSGRRWRDDWGR 207
50313280  158 MSMCALIAMVATLPREPQGGNIVVTTLNVDEHVRRLRTRARIGEQIDMKLIATLRNVYSMLANTSNFLRSGRVWRDGWGE 237
216905892 158 MSMCALIAMVATLPREPQGGNIVITTLNVDEHVRRLRTRARIGEQIDMKLIATLRNVYSMLANTSNFLRSGRVWRDGWGE 237
270339476 154 MTLGSVLSLMATLPREPPGGNLVVTTLNIEEHLKRLRGRSRTGEQIDMKLIHALRNVYMMLVHTKKFLTKNTSWRDGWGK 233
9629852   153 INAEDLLMLAAAMPPEAPGANLVVCTLPPAEQQRRLAARARPGDRADAGFLVAVRNAYALLVNTCAFLRAGGAWRDGWDA 232
296316038 229 LGWADADALAALAdpRGGGREPVPAPALRDTLFAALKCRELYPGGGAdLPAVHAWALDALADRLAALEVFMLDVSAAPDA 308
9629765   238 LPTSCGAYKHRAT--QMDAFQERVSPELGDTLFALFKTQELLDDRGV-ILEVHAWALDALMLKLRNLNVFSADLSGTPRQ 314
51557518  208 APRFDQTTRDCLA--LNELCRPRDDPELQDTLFGAYKAPELCDRRGR-PLEVHAWAMDALVAKLLPLRVSTVDLGPSPRV 284
50313280  238 LPLSCETYKHRAT--QMDAFQERESPELSDTLFAMFKTPELLDDRGV-ILEVHAWALDALMLKLRNLSVFCADLSGTPRQ 314
216905892 238 LPLSCETYKHRAT--QMDAFQERESPELGDTLFAMFKTPELLDDRGV-ILEVHAWALDALMLKLRNLSVFCADLSGTPRQ 314
270339476 234 LKIFSHYERNRLV--ETTIVSDSTESDLCDTLFSVFKARELSDQNGD-LLDMHAWVLDGLMETLQNLQIFTLNLEGTPDE 310
9629852   233 LEWADANALAALAdpSCDECKMAPAPALRDTLFAALKCRELYPGGGTgLPAVHAWALDALAGRLAALEVFVLDVSAAPDA 312
296316038 309 CAAAVLGMRPAMRAARADGAAGATLADLARRFAREMtpggpeaaprGL 356
9629765   315 CAAVVESLLPLMSSTLSDFDSASALERAARTFNAEM----------GV 352
51557518  285 CAAAVAAQTRGME--VTESAYGDHIRQCVCAFTSEM----------GV 320
50313280  315 CAATVESLIPLMSSTLSDSESASSLERAARTFNAEM----------GV 352
216905892 315 CAATVESLIPLMSSTLSDSESASSLERAARTFNAEM----------GV 352
270339476 311 CAAALGALRQDMDMTFIAACDMHRISEALTIYH--------------- 343
9629852   313 CAAAVLDMRPAMQAACADGAAGATLATLARQFALEMageat-agprGL 359
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap