Conserved Protein Domain Family
PHA03133

?
PHA03133: PHA03133 
thymidine kinase; Provisional
Statistics
?
PSSM-Id: 165405
View PSSM: PHA03133
Aligned: 5 rows
Threshold Bit Score: 622.331
Threshold Setting Gi: 83722591
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
9629292    1 MASHAGQQHAPAFGQAARASGPTDGRaasrpshrqgaSgargdpelpTLLRVYIDGPHGVGKTTTSAQLMEALGPRDNIV 80 
83722591   1 MASHAGQQDAPALDRATGSPDHRNRS-----------S---------ALLRIYVDGPHGLGKTTTAAAFAAALRRVDQIE 60 
56694745   1 MASHAGQQDAPALDRVAGSPGHGARAagsfglrdgrpS---------AMLRIYVDGPHGLGKTTTAAAFAAALGKSDGVE 71 
9629403    1 MASYPCHQHASAFDQAARSRGHNNRRtalrprrqqkaTevrleqkmpTLLRVYIDGPHGMGKTTTT-QLLVALGSRDDIV 79 
30984502   1 MASHAGHQDAPALDRVAGPAGHDNRP-----------S---------ALLRIYVDGPHGLGKTTTAAALAAALGRRDEIE 60 
9629292   81 YVPEPMTYWQVLGASETLTNIYNTQHRLDRGEISAGEAAVVMTSAQITMSTPYAATDAVLAPHIGGEAVGPQAPPP--AL 158
83722591  61 YVPEPMAYWQTLGGRETIARIFDAQHRLDRGEISAAEAAMAMASAQVTMSTPYAVTESAVAPHIGPELPPGHKPHPsiDL 140
56694745  72 YVPEPMAYWQKLGGAETIARIFDAQHRLDRGEISVAEAAMAMTSAQVTMSTPYAVTEAAVAPHIGPELPPDHRPHPtiDL 151
9629403   80 YVPEPMTYWRVLGASETIANIYTTQHRLDQGEISAGDAAVVMTSAQITMGMPYAVTDAVLAPHIGGEAGSSHAPPP--AL 157
30984502  61 YVPEPMAYWQTLGGPQTITRIFDAQHRLDRGEISAGEAAVAMASAQVTMSTPYAVTESAVAPHIGAELPPGHGPHPniDL 140
9629292  159 TLVFDRHPIASLLCYPAARYLMGSMTPQAVLAFVALMPPTAPGTNLVLGVLPEAEHADRLARRQRPGERLDLAMLSAIRR 238
83722591 141 ILVFDRHPVAPLVCYPAARYLTGSLSLPTVLSFAALLPPTTPGTNLVLGALPEAAHVERLAQRQRPGERLDLAMLSAIRR 220
56694745 152 ILVFDRHPVAPLLCYPAARYLVGSLSLPAVLSFAALLPPTTPGTNLVLGDLPAVAHAERLAQRHRPGERLDLAMLSAIRR 231
9629403  158 TLIFDRHPIAALLCYPAARYLMGSMTPQAVLAFVALIPPTLPGTNIVLGALPEDRHIDRLAKRQRPGERLDLAMLAAIRR 237
30984502 141 TLVFDRHPVAPLLCYPAARYLMGSLSLPTVLSFAALLPQTTPGTNLVLGALPEAVHAERLAQRQRPGERLDLAMLSAIRR 220
9629292  239 VYDLLANTVRYLQRGGRWREDWGRLTGVAAATPRPDPEdGAGSLPRIEDTLFALFRVPELLAPNGDLYHIFAWVLDVLAD 318
83722591 221 VYAMLGNAILYLQTGGSWRADWRRLSPARPAAESRRPE-RILPHPEIEDTIFALFCAPELLDETGEPFRVFAWTLDLLAE 299
56694745 232 VYAMLGNTILYLQTGGSWRADWHRLA---PAVESRRPE-RIMPHPKIEDTLFALFCAPELLDETGELYRVFAWTLDLLAE 307
9629403  238 VYGLLANTVRYLQGGGSWREDWGQLSGAAVPPQGAEPQsNAGPRPHIGDTLFTLFRAPELLAPNGDLYNVFAWALDVLAK 317
30984502 221 VYDMLGNAIVYLQQGGSWRADWRRLSPARPAAASGRPA-RILPRPEIEDTIFALFCAPELLDGTGEPYRVFAWTLDLLAE 299
9629292  319 RLLPMHLFVLDYDQSPVGCRDALLRLTAGMIPTRVTTAGSIAEIRDLARTFAREVGGV 376
83722591 300 RLRSMHLFVLDYNQATRHCWMDLMETTPEMTPTLVTNPGSLTALRTLAREFAREMAPA 357
56694745 308 RLRSMHLFVLDYNQATRHCWMDLMEATPEMTPTLVTTPGSLTVLRTLAREFAREMAPA 365
9629403  318 RLRPMHVFILDYDQSPAGCRDALLQLTSGMVQTHVTTPGSIPTICDLARTFAREMGEA 375
30984502 300 RLRPMHLLVLDYNQAPHHCWMDLMEMIPEMTPTLPATPGSMLTLQLLAREFAREMTSA 357
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap