Conserved Protein Domain Family
PHA03128

?
PHA03128: PHA03128 
dUTPase; Provisional
Statistics
?
PSSM-Id: 165400
View PSSM: PHA03128
Aligned: 3 rows
Threshold Bit Score: 670.507
Threshold Setting Gi: 51556560
Created: 9-Dec-2010
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
52139246   1 MLTMLTDRIDSQLVLSRLPRSRFQRFWETPTLIMKEESAPSSGsiILAEKSVNMRYCVRFASDSDFQTTFTLPqsteeky 80 
20026663   1 MLTVLTDRIDSQIVLSRPAHSRFQRFWEPPSLIIKDNGDPPPP--MLAEKSLNMRYCVRFASDTDFQNLFTPP------- 71 
51556560  13 MLNVLSDRLDQQLSLVKQHKSRFQRLWRRASLIKNDERQEPQD-----EHSVNLRYCLLFASNLNFQNVFRHP------- 80 
52139246  81 dkEQHPGEDEASSPLPSPlKVPYKWMPSSFIVKQCHTQLAFYNKHIIWLSRERKVPTSLGVSLYIPEGFFGITFYKCLDA 160
20026663  72 --DDGGGGGDGGSPLPQP-KIPYKWLPSSFIVKQCQTQLAFHNKHIIWLSRERKIPTSLGISLYIPEGFFGITFYKCLDA 148
51556560  81 ---------ESNIYSPRR-NVPYKWIPSSFIVRQQHMQLAFYNKHIIWLSEQPNTSTPLGINLYIPTGYFGITFYKCLDS 150
52139246 161 QFVCMPELLESGLQVPQLDVVNLNDTFQSIFPGTIEGDIGVFPCFVPEPWQLMNLPPPNEHRFFSLRTRQTLVIGPGHTQ 240
20026663 149 QFVCMPELIEPGLQMPQMDIVNLSYNFQAIFPGTIEGDIGVFPCFAPEPWQLMNVPPPNEHGFFTLRTRHTVIIRAGHTQ 228
51556560 151 QFVCMPELIEPGLQNLSMDVINLNYTFQAITPGTIEGDLCIFPCFCPEPWQVMNISPPNENYFFGLRLHQRIIIQPGHTQ 230
52139246 241 TVYFDAAYVHAPGICALIVGVRQFSQSDLIIRPTIWLPGTAAGVTVVNTSHTTVCISPHTTVAKAVFTTHRFTYLPVGSH 320
20026663 229 TVYFDAAYVHAPGICALIVGTRHFSQSDLIIRPTIWLPGTVACVTVVNASGTTVCISPNTTMTKVVFTTRRFAYLLVGSH 308
51556560 231 TVYLDAAFIHAPSTCALIVGTRQMNQLGIIIRPVIWLPGTVATITLVNTSSSAVYISGTTSVAKVVFTTRRFVYLLVHNH 310
52139246 321 PLGQMIVPPTPDIGFTHTPEHALLQRTPSPVDDDVD-----ETEEDEKSSDAESPVNTSDVIFDVGPKPPRHP 388
20026663 309 PIGQLIVPPTPELGFTHTPEHALLQRLSGCAGGGDDtaadaDDEEDEDTGATWSHRKRAVHHWDVVDRPYSSH 381
51556560 311 PIGQLLVPPTPDTGFTHMPEHHILQQLLACENE---------------------------------------- 343
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap