Conserved Protein Domain Family
PHA03126

?
PHA03126: PHA03126 
dUTPase; Provisional
Statistics
?
PSSM-Id: 165398
View PSSM: PHA03126
Aligned: 3 rows
Threshold Bit Score: 701.78
Threshold Setting Gi: 9629808
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
9629808     1 MASVTNLADNIVVVECSNGWEARAEADGRLLVLINNHTVELSAGLGSAGEFYSVLTDVGVRVACSSGYAIVLAQISGLPH 80 
50313250    1 MASVTNLVDSIVVVECGERWRARAEAAGRLLVLINNHTVELSGEHGSAGEFYSVLTDVGVRVACSSGYAIVLTQISGLLP 80 
216905862   1 MASVTNLVDSIVVVECGKRWRARAEAAGRLLVLINNHTVELSAEHGSAGEFYSVLTDVGLRVACSSGYAIVLTQISGLLP 80 
9629808    81 VGREPGNFSNITFTGNLANYYTAYGIVDSGYRGVVKAVQFANGVNTVVPPGCMSLGLVLVKLSTETINVTNINLTENGRS 160
50313250   81 VEPEPGNFSNVTFPENSAKYYTAYGIVDSGYRGVVKAVQFAPGINTSVPPGQMSLGLVLVKLARKSIHVTSIGSTRDGRT 160
216905862  81 VEPEPKNFSNVTFPGNSAKYYTAYGIVDSGYRGVVKAVQFAPGVNTSVPPGQMSLGLVLVKLAKEAIHVTSIGSTKDGRA 160
9629808   161 PRVNIFYDYFAPKRDEDAGYDISAQTNATIEPDESYFVELPIVFYSSNPAVTPCIFGRSSMNRRGLIVLPTRWVTGRTCC 240
50313250  161 SEANLFYDYFAPKRVEDAGYDISAPEDATIDPDESHFVDLPIVFANSNPAVTPCIFGRSSMNRRGLIVLPTRWVAGRTCC 240
216905862 161 SEANLFYDYFAPKRVEDAGYDISAPADATIGPDESHLVDLPIVFAHSNPAVTPCIFGRSSMNRRGLIVLPTRWVAGRTCC 240
9629808   241 FFILNINKYPVYITKGQRVAQLVLTEDIDEALIPTNVNYNTPFPTYSPTGAVKHNPTPILWKFTEAFDHDAPSSARSEGG 320
50313250  241 FFILNVNKYPVSITKGQRVAQLLLTEDIDDALIPPTVNYDNPFPTYSPSESTKAPQSPVLWKFTTDFDREAPSSLRADGG 320
216905862 241 FFILNVNKYPVSITKGQRVAQLLLTEDIDDALIPQTVNYDDPFPTYSPTDTTKAPQSPVLWKFTTDFDREAPSSLRADGG 320
9629808   321 FGSTGL 326
50313250  321 FGSTGL 326
216905862 321 FGSTGL 326
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap