Conserved Protein Domain Family
PHA03124

?
PHA03124: PHA03124 
dUTPase; Provisional
Statistics
?
PSSM-Id: 165396
View PSSM: PHA03124
Aligned: 2 rows
Threshold Bit Score: 784.902
Threshold Setting Gi: 38638201
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
38638201   1 MEATTKKMAMIEIGKGWAASCLEARTCVISNEEDIYAEPRADTPVLKLDSTVRTALPPGYGIVISGtARNHKTAWEIVPG 80 
57790936   3 MEMTTEKNALIEIGSGWDIFGLDSLQCVITNVEATIAKTRTDSPVLRIDSAIRTSLPVGYGIVISD-VEGHAACYQIIPG 81 
38638201  81 LVDSGYTGLLGLLLVPTDE---TPATGSAGGGIVSFSRGGVHARLTVIKLVPDDIMGACGAGAQRLPLKTAiTSFKGDED 157
57790936  82 LVDADYTGLLGILVVLVNDggnVLTGTETRDGNVIFPPGTVRARLNVIKLANDSMLSKCGTGYARLLLETA-DSFQGEDD 160
38638201 158 LLGNGFDHCMESLASIYPDILHVQLDCPVYFGCTGCKAFYRRLGSCLETRplNELGSDHIYLRRGSAYESVNRFAAPDDV 237
57790936 161 YLGEGFEKCISSLLSIPPDILRAKITIPGNIGCMGCTTFYRRTFEELQEQ--DAACNERIVILNGATPENINRFCGASNI 238
38638201 238 MFVAMYGKWLLIGMAETPNEKLTVELRDDDSSPAALIPFHDTFGQKEAEDAGYDIRAPENCTLPPGGSVRVILRQKLHMG 317
57790936 239 KFVAQVRHHIIVGATRSLVKDQTVELRSDPDCPAALFPFNEIFAPKRPGDGGYDIRATKDVTILPKSSTRITLPQKLACG 318
38638201 318 KGRAAFVMGRSSMNLKGVLVEPERVVDDEWVSFNITNIRDAAAFFRKNDRIAQLVALEDKLELMGGVDALPWRVVQSVQE 397
57790936 319 PFWRAFILGRSSMNLKGLLVDPIHVQDNDWISFSLTNIRDEAASIHAGDRVAQLIVTEKRSTFLGEPDALRWKIVNSVVD 398
38638201 398 EKKN-SSRGDKGFGSSGV 414
57790936 399 ERNTlSVRGDGGFGSTGK 416
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap