Conserved Protein Domain Family
PHA03123

?
PHA03123: PHA03123 
dUTPase; Provisional
Statistics
?
PSSM-Id: 165395
View PSSM: PHA03123
Aligned: 2 rows
Threshold Bit Score: 709.834
Threshold Setting Gi: 9625883
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
13242464   3 NSKEQFEAMIAAAENRErtGILERRRQRNEYYRDEILLDVGMRNNSDFNCALDGDCGWNQPVVLWNRRKITLPSDEAMEC 82 
9625883    1 MNEAVIDPILETAVNTG--DMFCSQTIPNRCLKDTILIEVQPECADTLQCVLDDKVSRHQPLLLRNHKKLELPSEKSVTR 78 
13242464  83 GDFYIQRLDLGVKASTPNGYALLLLRCIHSNPDKNTDVFIANGVIDSGYRGRICAVLYYKKNVTIIRPGDLMVYLLPVKL 162
9625883   79 GGFYMQQLELLVKSAPPNEYALLLIQCKDTALADEDNFFVANGVIDAGYRGVISALLYYRPGVTVILPGHLTIYLFPVKL 158
13242464 163 ATSYVLNVVYDNSLDPVLAEHMC-------VGKEKIAMKLFNDVnNAIKTGEQCIKSHCNYtetHVPIRLIFSNtLFKSK 235
9625883  159 RQSRLLPKNVLKHLDPIFKSIQVqplsnspSNYEKPVIPEFADI-STVQQGQPLHRDSAEY---HIDVPLTYKH-IINPK 233
13242464 236 RVEDAGYDVCAPFEITVPARTTIRVTVPFIQRLNVN--NMDAYIFGRSSKNVIGVIVLPTVWIWGSLCEFYIFNATSSNV 313
9625883  234 RQEDAGYDICVPYNLYLKRNEFIKIVLPIIRDWDLQhpSINAYIFGRSSKSRSGIIVCPTAWPAGEHCKFYVYNLTGDDI 313
13242464 314 IVKPGEKIAQVVLLEHRNQsVHIHKDIINNFePFPSIIFGNHTIEKLnspdvypKWHFTTMFNYIAPPSDRGNKGFGSTD 393
9625883  314 RIKTGDRLAQVLLIDHNTQ-IHLKHNVLSNI-AFPYAIRGKCGIPGV-------QWYFTKTLDLIATPSERGTRGFGSTD 384
13242464 394 VE 395
9625883  385 KE 386
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap