Conserved Protein Domain Family
PHA03120

?
PHA03120: PHA03120 
tegument protein VP22; Provisional
Statistics
?
PSSM-Id: 165393
View PSSM: PHA03120
Aligned: 2 rows
Threshold Bit Score: 481.956
Threshold Setting Gi: 13242465
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
9625884    1 MASSDGDRLCRSNAVRRKTTPS------YSGQYRT--ARRSVVVGPPDDSDDSLGYITTVGADSPSPVYADLYFEHKNTT 72 
13242465   1 MASPDGDRIRRSNAVRRKHMDAqyvnvpYVGKPRNpvPRRSVVVGFPDDSDDSLGYIATVETESPPLFYGDTSGTVDKRH 80 
9625884   73 PRVhQPNDSSGSEDDFEDIDEVVAAFREARLRHELVEDAVYENPLSVEKPSRSFTKNAavkpKLEDSPKRAPPGAGAIAS 152
13242465  81 TRM-ISNNSSDSDDDFEDIDEVIAAFKEARLKHEHVEDAVYENVQHGNAQPRMIQKHN----RDVDSPKRAPPGAGAIAS 155
9625884  153 GRPISFSTAPKTATSSWCGPTPSYNKRVFCEAVRRVAAMQAQKAAEAAWNSNPPRNNAELDRLLTGAVIRITVHEGLNLI 232
13242465 156 GRPLSFSTAPKNTTSAWCGPTPAYNKRVFCEAIRRIAAAQAQRAAEAAWSSNPPRNNAELDRLLAGTVVRITVHEGLNLI 235
9625884  233 QAANEADLGeGASVSKRGHNRKTGDLQGGMGNEPMYAQVrKPKSRTDTQTTGriTNRSRARSASRTDTRK 302
13242465 236 QVANDLELG-GKPDRKQSTARRKKEIVKDTDDEPVYAQV-KINSRGTQPVSG--TSRARTRSVSKPDGRK 301
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap